Property Summary

NCBI Gene PubMed Count 10
PubMed Score 3.16
PubTator Score 2.93

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
astrocytic glioma -3.000 4.5e-03
ependymoma -2.800 4.7e-03
oligodendroglioma -2.400 2.0e-15
glioblastoma -5.100 9.7e-06
sonic hedgehog group medulloblastoma -2.400 8.0e-04
atypical teratoid / rhabdoid tumor -3.900 9.2e-05
medulloblastoma, large-cell -3.400 2.0e-03
primitive neuroectodermal tumor -2.200 2.4e-02
interstitial cystitis -2.300 6.4e-04
lung adenocarcinoma -2.300 2.2e-13
adult high grade glioma -5.500 1.5e-07
pilocytic astrocytoma -2.900 1.2e-06
subependymal giant cell astrocytoma -2.285 3.6e-02
ovarian cancer -2.000 8.7e-14
pituitary cancer 3.300 1.9e-08

Gene RIF (4)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20210798 DOK-6 is involved in RET signaling with less influence when compared with DOK-1, DOK-4, and SHC.
18187620 Knockdown of docking protein 6 (DOK6) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
15286081 Dok-6 binds to the phosphorylated Ret Tyr(1062) residue resulting in phosphorylation of tyrosine residue(s) located within the unique C terminus of Dok-6 predominantly through a Src-dependent mechanism

AA Sequence

MASNFNDIVKQGYVKIRSRKLGIFRRCWLVFKKASSKGPRRLEKFPDEKAAYFRNFHKVTELHNIKNITR      1 - 70
LPRETKKHAVAIIFHDETSKTFACESELEAEEWCKHLCMECLGTRLNDISLGEPDLLAAGVQREQNERFN     71 - 140
VYLMPTPNLDIYGECTMQITHENIYLWDIHNAKVKLVMWPLSSLRRYGRDSTWFTFESGRMCDTGEGLFT    141 - 210
FQTREGEMIYQKVHSATLAIAEQHERLMLEMEQKARLQTSLTEPMTLSKSISLPRSAYWHHITRQNSVGE    211 - 280
IYSLQGHGFGSSKMSRAQTFPSYAPEQSEEAQQPLSRSSSYGFSYSSSLIQ                       281 - 331
//

Text Mined References (11)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24483146 2014 Discovery of genetic biomarkers contributing to variation in drug response of cytidine analogues using human lymphoblastoid cell lines.
20548944 2010 An integration of genome-wide association study and gene expression profiling to prioritize the discovery of novel susceptibility Loci for osteoporosis-related traits.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20210798 2010 Analysis of DOK-6 function in downstream signaling of RET in human neuroblastoma cells.
16273093 2006 A quantitative protein interaction network for the ErbB receptors using protein microarrays.
16177791 2005 DNA sequence and analysis of human chromosome 18.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15286081 2004 Dok-6, a Novel p62 Dok family member, promotes Ret-mediated neurite outgrowth.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.