Property Summary

NCBI Gene PubMed Count 10
PubMed Score 3.37
PubTator Score 2.93

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
adult high grade glioma -5.500 1.5e-07
astrocytic glioma -3.000 4.5e-03
Astrocytoma, Pilocytic -2.900 1.5e-06
atypical teratoid / rhabdoid tumor -3.900 9.2e-05
ependymoma -2.800 4.7e-03
glioblastoma -3.900 1.3e-07
interstitial cystitis -2.300 6.4e-04
lung adenocarcinoma -1.200 4.6e-18
medulloblastoma -1.500 4.7e-02
medulloblastoma, large-cell -3.400 2.0e-03
oligodendroglioma -2.300 6.7e-03
ovarian cancer -2.000 8.7e-14
pituitary cancer 3.300 1.9e-08
primitive neuroectodermal tumor -2.200 2.4e-02
subependymal giant cell astrocytoma -2.285 3.6e-02

Gene RIF (4)

AA Sequence

MASNFNDIVKQGYVKIRSRKLGIFRRCWLVFKKASSKGPRRLEKFPDEKAAYFRNFHKVTELHNIKNITR      1 - 70
LPRETKKHAVAIIFHDETSKTFACESELEAEEWCKHLCMECLGTRLNDISLGEPDLLAAGVQREQNERFN     71 - 140
VYLMPTPNLDIYGECTMQITHENIYLWDIHNAKVKLVMWPLSSLRRYGRDSTWFTFESGRMCDTGEGLFT    141 - 210
FQTREGEMIYQKVHSATLAIAEQHERLMLEMEQKARLQTSLTEPMTLSKSISLPRSAYWHHITRQNSVGE    211 - 280
IYSLQGHGFGSSKMSRAQTFPSYAPEQSEEAQQPLSRSSSYGFSYSSSLIQ                       281 - 331
//

Text Mined References (11)

PMID Year Title