Property Summary

NCBI Gene PubMed Count 22
PubMed Score 11.38
PubTator Score 16.09

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Gene RIF (8)

AA Sequence

MASNFNDIVKQGYVRIRSRRLGIYQRCWLVFKKASSKGPKRLEKFSDERAAYFRCYHKVTELNNVKNVAR      1 - 70
LPKSTKKHAIGIYFNDDTSKTFACESDLEADEWCKVLQMECVGTRINDISLGEPDLLATGVEREQSERFN     71 - 140
VYLMPSPNLDVHGECALQITYEYICLWDVQNPRVKLISWPLSALRRYGRDTTWFTFEAGRMCETGEGLFI    141 - 210
FQTRDGEAIYQKVHSAALAIAEQHERLLQSVKNSMLQMKMSERAASLSTMVPLPRSAYWQHITRQHSTGQ    211 - 280
LYRLQDVSSPLKLHRTETFPAYRSEH                                                281 - 306
//

Text Mined References (23)

PMID Year Title