Property Summary

NCBI Gene PubMed Count 20
PubMed Score 44.39
PubTator Score 18.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
osteosarcoma -4.308 2.3e-06
non-small cell lung cancer -1.426 1.2e-13
interstitial cystitis 2.800 3.4e-04
primary Sjogren syndrome 1.900 1.0e-04
subependymal giant cell astrocytoma 1.580 3.0e-02
inflammatory breast cancer 1.100 1.7e-02
ulcerative colitis 2.200 1.1e-04

Gene RIF (6)

PMID Text
27265473 DOK2 and DOK3 expression was significantly reduced in HTLV-1-infected T cells.
23223229 The Dok-3/Grb2 protein signal module attenuates Lyn kinase-dependent activation of Syk kinase in B cell antigen receptor microclusters
22761938 absence of DOK3 increases LPS signaling, contributing to LPS-induced tolerance. Thus, DOK3 plays a role in TLR signaling during both naive and endotoxin-induced tolerant conditions
20139980 Identification of DOK genes as lung tumor suppressors.
19682241 The novel platelet adapter Dok-3 is tyrosine phosphorylated in an Src kinase-independent manner downstream of alphaIIbbeta3 in human platelets, leading to an interaction with Grb2 and SHIP-1.
16436051 findings indicate that Dok-3 sequesters Grb2 from Shc and inhibits the Ras-Erk pathway downstream of PTKs

AA Sequence

MTRGARLRSDARAQLNQLSLDGGTGSGQKGKCEEFPSSLSSVSPGLEAAALLLAVTMDPLETPIKDGILY      1 - 70
QQHVKFGKKCWRKVWALLYAGGPSGVARLESWEVRDGGLGAAGDRSAGPGRRGERRVIRLADCVSVLPAD     71 - 140
GESCPRDTGAFLLTTTERSHLLAAQHRQAWMGPICQLAFPGTGEASSGSTDAQSPKRGLVPMEENSIYSS    141 - 210
WQEVGEFPVVVQRTEAATRCQLKGPALLVLGPDAIQLREAKGTQALYSWPYHFLRKFGSDKGVFSFEAGR    211 - 280
RCHSGEGLFAFSTPCAPDLCRAVAGAIARQRERLPELTRPQPCPLPRATSLPSLDTPGELREMPPGPEPP    281 - 350
TSRKMHLAEPGPQSLPLLLGPEPNDLASGLYASVCKRASGPPGNEHLYENLCVLEASPTLHGGEPEPHEG    351 - 420
PGSRSPTTSPIYHNGQDLSWPGPANDSTLEAQYRRLLELDQVEGTGRPDPQAGFKAKLVTLLSRERRKGP    421 - 490
APCDRP                                                                    491 - 496
//

Text Mined References (25)

PMID Year Title
27265473 2016 Expression of DOK1, 2, and 3 genes in HTLV-1-infected T cells.
25814554 2015 Phospho-tyrosine dependent protein-protein interaction network.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23223229 2013 The Dok-3/Grb2 protein signal module attenuates Lyn kinase-dependent activation of Syk kinase in B cell antigen receptor microclusters.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
22761938 2012 DOK3 negatively regulates LPS responses and endotoxin tolerance.
21269460 2011 Initial characterization of the human central proteome.
20139980 2010 Identification of DOK genes as lung tumor suppressors.
19682241 2009 Proteomic analysis of integrin alphaIIbbeta3 outside-in signaling reveals Src-kinase-independent phosphorylation of Dok-1 and Dok-3 leading to SHIP-1 interactions.
18088087 2008 Phosphoproteome of resting human platelets.
17290227 2007 Subcellular localization of Grb2 by the adaptor protein Dok-3 restricts the intensity of Ca2+ signaling in B cells.
16436051 2006 Dok-3 sequesters Grb2 and inhibits the Ras-Erk pathway downstream of protein-tyrosine kinases.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
14993273 2004 Inhibition of the Jun N-terminal protein kinase pathway by SHIP-1, a lipid phosphatase that interacts with the adaptor molecule Dok-3.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12595900 2003 DOK4 and DOK5: new Dok-related genes expressed in human T cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11470823 2001 Novel p62dok family members, dok-4 and dok-5, are substrates of the c-Ret receptor tyrosine kinase and mediate neuronal differentiation.
10733577 2000 Dok-3, a novel adapter molecule involved in the negative regulation of immunoreceptor signaling.
10567556 1999 Characterization of a novel member of the DOK family that binds and modulates Abl signaling.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.