Property Summary

NCBI Gene PubMed Count 44
PubMed Score 37.77
PubTator Score 24.79

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Lung Neoplasms 232 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

Expression

  Differential Expression (8)

Disease log2 FC p
cutaneous lupus erythematosus 1.300 4.8e-03
interstitial cystitis 1.100 3.6e-03
lung adenocarcinoma -1.100 7.9e-08
lung carcinoma -1.300 2.1e-15
mucosa-associated lymphoid tissue lympho... 1.691 1.3e-02
non-small cell lung cancer -1.640 4.3e-24
osteosarcoma -1.365 1.6e-03
spina bifida 1.175 4.1e-02

Protein-protein Interaction (5)

Gene RIF (23)

AA Sequence

MGDGAVKQGFLYLQQQQTFGKKWRRFGASLYGGSDCALARLELQEGPEKPRRCEAARKVIRLSDCLRVAE      1 - 70
AGGEASSPRDTSAFFLETKERLYLLAAPAAERGDWVQAICLLAFPGQRKELSGPEGKQSRPCMEENELYS     71 - 140
SAVTVGPHKEFAVTMRPTEASERCHLRGSYTLRAGESALELWGGPEPGTQLYDWPYRFLRRFGRDKVTFS    141 - 210
FEAGRRCVSGEGNFEFETRQGNEIFLALEEAISAQKNAAPATPQPQPATIPASLPRPDSPYSRPHDSLPP    211 - 280
PSPTTPVPAPRPRGQEGEYAVPFDAVARSLGKNFRGILAVPPQLLADPLYDSIEETLPPRPDHIYDEPEG    281 - 350
VAALSLYDSPQEPRGEAWRRQATADRDPAGLQHVQPAGQDFSASGWQPGTEYDNVVLKKGPK            351 - 412
//

Text Mined References (46)

PMID Year Title