Property Summary

NCBI Gene PubMed Count 22
PubMed Score 5.51
PubTator Score 8.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
interstitial lung disease -1.100 3.2e-02
malignant mesothelioma -1.200 1.3e-04
astrocytic glioma -2.100 2.0e-02
ependymoma -2.000 1.5e-11
oligodendroglioma -1.500 2.0e-02
esophageal adenocarcinoma -1.700 2.6e-02
psoriasis -1.900 9.7e-05
glioblastoma -2.500 8.1e-03
group 4 medulloblastoma -2.300 8.9e-05
atypical teratoid / rhabdoid tumor -2.400 1.5e-07
medulloblastoma, large-cell -1.500 2.4e-03
primitive neuroectodermal tumor -1.300 1.5e-04
juvenile dermatomyositis 1.169 2.5e-09
non-small cell lung cancer -1.380 8.3e-15
lung cancer -2.800 4.8e-04
active Crohn's disease 1.088 2.2e-02
lung adenocarcinoma -1.600 3.3e-12
adult high grade glioma -2.600 5.9e-06
subependymal giant cell astrocytoma -2.710 3.2e-02
spina bifida -1.904 2.3e-02
mucosa-associated lymphoid tissue lympho... 1.262 2.2e-02
sarcoidosis -1.100 4.8e-03
dermatomyositis 1.300 3.1e-03

Gene RIF (10)

PMID Text
26641546 c.2262A>C substitution in DOCK9 leads to a splicing aberration. However, because the mutation effect was observed in vitro, a definitive relationship between DOCK9 and KTCN phenotype could not be established.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19809089 Studies indicate that that many of the mechanistic principles of the exchange process are conserved in the DOCK9-catalyzed reaction.
19745154 through structural analysis of DOCK9-Cdc42 complexes, we identify a nucleotide sensor within the alpha10 helix of the DHR2 domain that contributes to release of guanine diphosphate (GDP) and then to discharge of the activated GTP-bound Cdc42
18729074 interaction between Smad2/3 and the Cdc42 guanine nucleotide exchange factor, Zizimin1, in response to TGF-beta1
18056264 DOCK2 and DOCK9 specifically recognize Rac2 and Cdc42 through their switch 1 as well as beta2-beta3 regions and the mode of recognition via switch 1 appears to be conserved among diverse Rac-specific DHR-2 GEFs
17935486 novel functions for the N-terminal region of zizimin1.
17728666 Observational study of gene-disease association. (HuGE Navigator)
17728666 DOCK9 contributes to both risk and increased illness severity in bipolar disorder.
12172552 Sequence comparison combined with mutational analysis identified a new domain, which we named CZH2, that mediates direct interaction with Cdc42

AA Sequence

MSQPPLLPASAETRKFTRALSKPGTAAELRQSVSEVVRGSVLLAKPKLIEPLDYENVIVQKKTQILNDCL      1 - 70
REMLLFPYDDFQTAILRRQGRYICSTVPAKAEEEAQSLFVTECIKTYNSDWHLVNYKYEDYSGEFRQLPN     71 - 140
KVVKLDKLPVHVYEVDEEVDKDEDAASLGSQKGGITKHGWLYKGNMNSAISVTMRSFKRRFFHLIQLGDG    141 - 210
SYNLNFYKDEKISKEPKGSIFLDSCMGVVQNNKVRRFAFELKMQDKSSYLLAADSEVEMEEWITILNKIL    211 - 280
QLNFEAAMQEKRNGDSHEDDEQSKLEGSGSGLDSYLPELAKSAREAEIKLKSESRVKLFYLDPDAQKLDF    281 - 350
SSAEPEVKSFEEKFGKRILVKCNDLSFNLQCCVAENEEGPTTNVEPFFVTLSLFDIKYNRKISADFHVDL    351 - 420
NHFSVRQMLATTSPALMNGSGQSPSVLKGILHEAAMQYPKQGIFSVTCPHPDIFLVARIEKVLQGSITHC    421 - 490
AEPYMKSSDSSKVAQKVLKNAKQACQRLGQYRMPFAWAARTLFKDASGNLDKNARFSAIYRQDSNKLSND    491 - 560
DMLKLLADFRKPEKMAKLPVILGNLDITIDNVSSDFPNYVNSSYIPTKQFETCSKTPITFEVEEFVPCIP    561 - 630
KHTQPYTIYTNHLYVYPKYLKYDSQKSFAKARNIAICIEFKDSDEEDSQPLKCIYGRPGGPVFTRSAFAA    631 - 700
VLHHHQNPEFYDEIKIELPTQLHEKHHLLLTFFHVSCDNSSKGSTKKRDVVETQVGYSWLPLLKDGRVVT    701 - 770
SEQHIPVSANLPSGYLGYQELGMGRHYGPEIKWVDGGKPLLKISTHLVSTVYTQDQHLHNFFQYCQKTES    771 - 840
GAQALGNELVKYLKSLHAMEGHVMIAFLPTILNQLFRVLTRATQEEVAVNVTRVIIHVVAQCHEEGLESH    841 - 910
LRSYVKYAYKAEPYVASEYKTVHEELTKSMTTILKPSADFLTSNKLLKYSWFFFDVLIKSMAQHLIENSK    911 - 980
VKLLRNQRFPASYHHAVETVVNMLMPHITQKFRDNPEASKNANHSLAVFIKRCFTFMDRGFVFKQINNYI    981 - 1050
SCFAPGDPKTLFEYKFEFLRVVCNHEHYIPLNLPMPFGKGRIQRYQDLQLDYSLTDEFCRNHFLVGLLLR   1051 - 1120
EVGTALQEFREVRLIAISVLKNLLIKHSFDDRYASRSHQARIATLYLPLFGLLIENVQRINVRDVSPFPV   1121 - 1190
NAGMTVKDESLALPAVNPLVTPQKGSTLDNSLHKDLLGAISGIASPYTTSTPNINSVRNADSRGSLISTD   1191 - 1260
SGNSLPERNSEKSNSLDKHQQSSTLGNSVVRCDKLDQSEIKSLLMCFLYILKSMSDDALFTYWNKASTSE   1261 - 1330
LMDFFTISEVCLHQFQYMGKRYIARTGMMHARLQQLGSLDNSLTFNHSYGHSDADVLHQSLLEANIATEV   1331 - 1400
CLTALDTLSLFTLAFKNQLLADHGHNPLMKKVFDVYLCFLQKHQSETALKNVFTALRSLIYKFPSTFYEG   1401 - 1470
RADMCAALCYEILKCCNSKLSSIRTEASQLLYFLMRNNFDYTGKKSFVRTHLQVIISVSQLIADVVGIGG   1471 - 1540
TRFQQSLSIINNCANSDRLIKHTSFSSDVKDLTKRIRTVLMATAQMKEHENDPEMLVDLQYSLAKSYAST   1541 - 1610
PELRKTWLDSMARIHVKNGDLSEAAMCYVHVTALVAEYLTRKEAVQWEPPLLPHSHSACLRRSRGGVFRQ   1611 - 1680
GCTAFRVITPNIDEEASMMEDVGMQDVHFNEDVLMELLEQCADGLWKAERYELIADIYKLIIPIYEKRRD   1681 - 1750
FERLAHLYDTLHRAYSKVTEVMHSGRRLLGTYFRVAFFGQAAQYQFTDSETDVEGFFEDEDGKEYIYKEP   1751 - 1820
KLTPLSEISQRLLKLYSDKFGSENVKMIQDSGKVNPKDLDSKYAYIQVTHVIPFFDEKELQERKTEFERS   1821 - 1890
HNIRRFMFEMPFTQTGKRQGGVEEQCKRRTILTAIHCFPYVKKRIPVMYQHHTDLNPIEVAIDEMSKKVA   1891 - 1960
ELRQLCSSAEVDMIKLQLKLQGSVSVQVNAGPLAYARAFLDDTNTKRYPDNKVKLLKEVFRQFVEACGQA   1961 - 2030
LAVNERLIKEDQLEYQEEMKANYREMAKELSEIMHEQLG                                  2031 - 2069
//

Text Mined References (28)

PMID Year Title
26641546 2015 Variant c.2262A>C in DOCK9 Leads to Exon Skipping in Keratoconus Family.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23414517 2013 A human skeletal muscle interactome centered on proteins involved in muscular dystrophies: LGMD interactome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19946888 2010 Defining the membrane proteome of NK cells.
19809089 2009 Snapshots form a big picture of guanine nucleotide exchange.
19745154 2009 Activation of Rho GTPases by DOCK exchange factors is mediated by a nucleotide sensor.
18729074 2008 Identification of novel Smad2 and Smad3 associated proteins in response to TGF-beta1.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18056264 2008 Specific recognition of Rac2 and Cdc42 by DOCK2 and DOCK9 guanine nucleotide exchange factors.
17935486 2008 Function of the N-terminus of zizimin1: autoinhibition and membrane targeting.
17728666 2007 Sequence variation in DOCK9 and heterogeneity in bipolar disorder.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057823 2004 The DNA sequence and analysis of human chromosome 13.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12432077 2002 Identification of an evolutionarily conserved superfamily of DOCK180-related proteins with guanine nucleotide exchange activity.
12172552 2002 Zizimin1, a novel Cdc42 activator, reveals a new GEF domain for Rho proteins.
12168954 2002 Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones.
11991713 2002 An evaluation of the assembly of an approximately 15-Mb region on human chromosome 13q32-q33 linked to bipolar disorder and schizophrenia.
10470851 1999 Prediction of the coding sequences of unidentified human genes. XIV. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.