Property Summary

NCBI Gene PubMed Count 32
PubMed Score 42.88
PubTator Score 36.38

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Disease log2 FC p
malignant mesothelioma -2.600 2.0e-08
psoriasis -1.500 7.0e-08
osteosarcoma 1.821 3.7e-03
ependymoma -2.000 1.6e-07
cystic fibrosis 4.000 4.9e-07
atypical teratoid / rhabdoid tumor -3.600 2.3e-06
glioblastoma -1.900 1.3e-04
medulloblastoma, large-cell -3.100 6.0e-07
primitive neuroectodermal tumor -1.400 1.0e-03
tuberculosis and treatment for 6 months -3.800 3.8e-06
non-small cell lung cancer -2.196 6.5e-26
intraductal papillary-mucinous adenoma (... -1.700 1.2e-02
intraductal papillary-mucinous carcinoma... -1.300 3.4e-02
lung cancer -2.900 1.0e-05
active Crohn's disease 2.050 2.1e-02
ulcerative colitis 1.800 7.7e-08
lung adenocarcinoma -1.492 2.7e-04
pediatric high grade glioma -1.300 1.5e-03
invasive ductal carcinoma 1.108 1.6e-02
nasopharyngeal carcinoma 1.400 8.7e-04
Breast cancer -1.100 4.7e-05
gastric carcinoma 1.700 3.1e-02
ovarian cancer -3.400 1.5e-08
Gaucher disease type 3 -1.100 2.2e-02

Gene RIF (17)

PMID Text
26578796 These data identify DOCK4 as a putative 7q gene whose reduced expression can lead to erythroid dysplasia
26129894 DOCK4 signalling is necessary for lateral filopodial protrusions and tubule remodelling prior to vascular lumen formation
25644601 activator DOCK4 as a key component of the TGF-beta/Smad pathway that promotes lung ADC cell extravasation and metastasis.
24599690 The study found significant associations between autism and a SNP of the DOCK4 gene.
23720743 The Atypical guanine nucleotide exchange factor Dock4 regulates neurite differentiation through modulation of Rac1 GTPase and actin dynamics.
21682944 This study revealed ROCK4 as novel schizophrenia candidate genes in the Jewish population.
21532034 novel epigenetic alterations in myelodysplastic leukocytes and implicate DOCK4 as a pathogenic gene located on the 7q chromosomal region.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20346443 Data suggest that exonic deletions of DOCK4 may act as a risk factor for reading impairment. Genomic disruption of both DOCK4 and CNTNAP5 genes may have an additive effect and may result in a more severe autism spectrum phenotype.
20346443 Observational study of gene-disease association. (HuGE Navigator)
19528233 Cell migration is regulated by platelet-derived growth factor receptor endocytosis, which involves DOCK4.
19401682 Evidence for the involvement of DOCK4 in autism susceptibility was supported by independent replication of association at rs2217262 and the finding of a deletion segregating in a sib-pair family
19401682 Observational study of gene-disease association. (HuGE Navigator)
19383911 Observational study of gene-disease association. (HuGE Navigator)
18641688 DOCK4 interacts with the beta-catenin degradation complex, consisting of the proteins adenomatosis polyposis coli, Axin and glycogen synthase kinase 3beta.
18459162 DOCK4 may be regulated by PIP(3) to exert its function
17027967 Taken together, these results suggest that Dock4 plays an important role in the regulation of cell migration through activation of Rac1, and that RhoG is a key upstream regulator for Dock4.

AA Sequence

MWIPTEHEKYGVVIASFRGTVPYGLSLEIGDTVQILEKCDGWYRGFALKNPNIKGIFPSSYVHLKNACVK      1 - 70
NKGQFEMVIPTEDSVITEMTSTLRDWGTMWKQLYVRNEGDLFHRLWHIMNEILDLRRQVLVGHLTHDRMK     71 - 140
DVKRHITARLDWGNEQLGLDLVPRKEYAMVDPEDISITELYRLMEHRHRKKDTPVQASSHHLFVQMKSLM    141 - 210
CSNLGEELEVIFSLFDSKENRPISERFFLRLNRNGLPKAPDKPERHCSLFVDLGSSELRKDIYITVHIIR    211 - 280
IGRMGAGEKKNACSVQYRRPFGCAVLSIADLLTGETKDDLILKVYMCNTESEWYQIHENIIKKLNARYNL    281 - 350
TGSNAGLAVSLQLLHGDIEQIRREYSSVFSHGVSITRKLGFSNIIMPGEMRNDLYITIERGEFEKGGKSV    351 - 420
ARNVEVTMFIVDSSGQTLKDFISFGSGEPPASEYHSFVLYHNNSPRWSELLKLPIPVDKFRGAHIRFEFR    421 - 490
HCSTKEKGEKKLFGFSFVPLMQEDGRTLPDGTHELIVHKCEENTNLQDTTRYLKLPFSKGIFLGNNNQAM    491 - 560
KATKESFCITSFLCSTKLTQNGDMLDLLKWRTHPDKITGCLSKLKEIDGSEIVKFLQDTLDTLFGILDEN    561 - 630
SQKYGSKVFDSLVHIINLLQDSKFHHFKPVMDTYIESHFAGALAYRDLIKVLKWYVDRITEAERQEHIQE    631 - 700
VLKAQEYIFKYIVQSRRLFSLATGGQNEEEFRCCIQELLMSVRFFLSQESKGSGALSQSQAVFLSSFPAV    701 - 770
YSELLKLFDVREVANLVQDTLGSLPTILHVDDSLQAIKLQCIGKTVESQLYTNPDSRYILLPVVLHHLHI    771 - 840
HLQEQKDLIMCARILSNVFCLIKKNSSEKSVLEEIDVIVASLLDILLRTILEITSRPQPSSSAMRFQFQD    841 - 910
VTGEFVACLLSLLRQMTDRHYQQLLDSFNTKEELRDFLLQIFTVFRILIRPEMFPKDWTVMRLVANNVII    911 - 980
TTVLYLSDALRKNFLNENFDYKIWDSYFYLAVIFINQLCLQLEMFTPSKKKKVLEKYGDMRVTMGCEIFS    981 - 1050
MWQNLGEHKLHFIPALIGPFLEVTLIPQPDLRNVMIPIFHDMMDWEQRRSGNFKQVEAKLIDKLDSLMSE   1051 - 1120
GKGDETYRELFNSILLKKIERETWRESGVSLIATVTRLMERLLDYRDCMKMGEVDGKKIGCTVSLLNFYK   1121 - 1190
TELNKEEMYIRYIHKLYDLHLKAQNFTEAAYTLLLYDELLEWSDRPLREFLTYPMQTEWQRKEHLHLTII   1191 - 1260
QNFDRGKCWENGIILCRKIAEQYESYYDYRNLSKMRMMEASLYDKIMDQQRLEPEFFRVGFYGKKFPFFL   1261 - 1330
RNKEFVCRGHDYERLEAFQQRMLNEFPHAIAMQHANQPDETIFQAEAQYLQIYAVTPIPESQEVLQREGV   1331 - 1400
PDNIKSFYKVNHIWKFRYDRPFHKGTKDKENEFKSLWVERTSLYLVQSLPGISRWFEVEKREVVEMSPLE   1401 - 1470
NAIEVLENKNQQLKTLISQCQTRQMQNINPLTMCLNGVIDAAVNGGVSRYQEAFFVKEYILSHPEDGEKI   1471 - 1540
ARLRELMLEQAQILEFGLAVHEKFVPQDMRPLHKKLVDQFFVMKSSLGIQEFSACMQASPVHFPNGSPRV   1541 - 1610
CRNSAPASVSPDGTRVIPRRSPLSYPAVNRYSSSSLSSQASAEVSNITGQSESSDEVFNMQPSPSTSSLS   1611 - 1680
STHSASPNVTSSAPSSARASPLLSDKHKHSRENSCLSPRERPCSAIYPTPVEPSQRMLFNHIGDGALPRS   1681 - 1750
DPNLSAPEKAVNPTPSSWSLDSGKEAKNMSDSGKLISPPVPPRPTQTASPARHTTSVSPSPAGRSPLKGS   1751 - 1820
VQSFTPSPVEYHSPGLISNSPVLSGSYSSGISSLSRCSTSETSGFENQVNEQSAPLPVPVPVPVPSYGGE   1821 - 1890
EPVRKESKTPPPYSVYERTLRRPVPLPHSLSIPVTSEPPALPPKPLAARSSHLENGARRTDPGPRPRPLP   1891 - 1960
RKVSQL                                                                   1961 - 1966
//

Text Mined References (35)

PMID Year Title
26578796 2015 Reduced DOCK4 expression leads to erythroid dysplasia in myelodysplastic syndromes.
26129894 2015 A Rac/Cdc42 exchange factor complex promotes formation of lateral filopodia and blood vessel lumen morphogenesis.
25644601 2015 TGF-?/Smad signaling through DOCK4 facilitates lung adenocarcinoma metastasis.
24599690 2014 Family-based association study of ZNF533, DOCK4 and IMMP2L gene polymorphisms linked to autism in a northeastern Chinese Han population.
24324551 2013 Genome wide association study (GWAS) of Chagas cardiomyopathy in Trypanosoma cruzi seropositive subjects.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23720743 2013 The atypical guanine nucleotide exchange factor Dock4 regulates neurite differentiation through modulation of Rac1 GTPase and actin dynamics.
22890011 2012 Genome-wide association study indicates variants associated with insulin signaling and inflammation mediate lipoprotein responses to fenofibrate.
22788528 2013 Genetic associations with C-reactive protein level and white blood cell count in the KARE study.
22747683 2012 Genetic variants associated with breast size also influence breast cancer risk.
22158624 2012 Bone morphogenetic protein 4 promotes vascular smooth muscle contractility by activating microRNA-21 (miR-21), which down-regulates expression of family of dedicator of cytokinesis (DOCK) proteins.
21682944 2012 DOCK4 and CEACAM21 as novel schizophrenia candidate genes in the Jewish population.
21532034 2011 Aberrant epigenetic and genetic marks are seen in myelodysplastic leukocytes and reveal Dock4 as a candidate pathogenic gene on chromosome 7q.
20679435 2010 Ephexin4 and EphA2 mediate cell migration through a RhoG-dependent mechanism.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20346443 2010 Characterization of a family with rare deletions in CNTNAP5 and DOCK4 suggests novel risk loci for autism and dyslexia.
19807924 2009 Identification of SH3 domain interaction partners of human FasL (CD178) by phage display screening.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19528233 2009 Cell migration is regulated by platelet-derived growth factor receptor endocytosis.
19401682 2010 High-density SNP association study and copy number variation analysis of the AUTS1 and AUTS5 loci implicate the IMMP2L-DOCK4 gene region in autism susceptibility.
19383911 2009 Analysis of DNA copy number alterations in ovarian serous tumors identifies new molecular genetic changes in low-grade and high-grade carcinomas.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18641688 2008 Molecular association between beta-catenin degradation complex and Rac guanine exchange factor DOCK4 is essential for Wnt/beta-catenin signaling.
18459162 2008 Identification of DOCK4 and its splicing variant as PIP3 binding proteins.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17027967 2006 Dock4 is regulated by RhoG and promotes Rac-dependent cell migration.
16464467 2006 An isoform of GTPase regulator DOCK4 localizes to the stereocilia in the inner ear and binds to harmonin (USH1C).
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16213364 2005 Finer delineation and transcript map of the 7q31 locus deleted in myeloid neoplasms.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12853948 2003 The DNA sequence of human chromosome 7.
12628187 2003 DOCK4, a GTPase activator, is disrupted during tumorigenesis.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12432077 2002 Identification of an evolutionarily conserved superfamily of DOCK180-related proteins with guanine nucleotide exchange activity.
9872452 1998 Prediction of the coding sequences of unidentified human genes. XI. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.