Property Summary

NCBI Gene PubMed Count 39
PubMed Score 44.68
PubTator Score 22.31

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
cutaneous lupus erythematosus 2.000 3.0e-03
psoriasis 1.300 1.1e-02
osteosarcoma -2.724 5.2e-04
periodontitis 1.100 2.8e-23
tuberculosis 1.500 1.1e-08
non-small cell lung cancer -1.474 2.8e-12
lung cancer -1.700 4.9e-03
interstitial cystitis 2.200 2.9e-03
pilocytic astrocytoma 1.300 1.1e-05
primary Sjogren syndrome 1.900 7.6e-04
invasive ductal carcinoma 1.662 4.8e-05
lung carcinoma -2.900 7.5e-32
spina bifida 1.259 3.6e-02
ulcerative colitis 2.100 1.1e-04
head and neck cancer -1.200 2.4e-02

Protein-protein Interaction (1)

Gene RIF (23)

PMID Text
26083206 Autosomal recessive DOCK2 deficiency is a new mendelian disorder with pleiotropic defects of hematopoietic and nonhematopoietic immunity.
24821968 findings reveal a previously unknown, nonredundant role for Elmo1 in controlling Dock2 levels and Dock2-dependent T cell migration in primary lymphocytes.
23986795 Interaction of HIV-1 Nef with a protein complex, which includes Rac2, DOCK2, and ELMO1, activates Rac activity in T cells
23911989 DOCK2 is required for the normal T and B cell migration and signal transduction. (Review)
23525077 DOCK2 mutations are associated with esophageal adenocarcinoma.
22844345 Interaction of HIV-1 Nef with a protein complex, which includes Rac2, DOCK2, and ELMO1, activates Rac activity in T cells
22331897 The C-terminal Pro-rich tail of ELMO1 winds around the Src-homology 3 domain of DOCK2 to form an intermolecular 5-helix bundle. The entire regions of both DOCK2 a& ELMO1 assemble to create a rigid structure required for the DOCK2 & ELMO1 binding.
21645150 Our results show CXCL13-mediated PCa cell invasion requires Akt and ERK12 activation and suggests a new role for DOCK2 in proliferation of hormone-refractory CXCR5-positive PCa cells.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20412587 prostate cancer cell lines differentially express phosphoinositide-3 kinase (PI3K) catalytic subunit isoforms and dedicator of cytokinesis 2
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20350533 This is the first report to clarify the prominent role of DOCK2 in hematopoietic malignancy.
20201926 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19729484 DOCK2 regulates microglial innate immunity independent of COX2 induction and DOCK2+ microglia are associated with human Alzheimer's disease pathology.
18662984 PI3K and Src-ELMO-Dock2 pathways work in parallel to activate Rac2 and modulate chemotaxis in response to a CXCL8 gradient in neutrophils.
18056264 DOCK2 and DOCK9 specifically recognize Rac2 and Cdc42 through their switch 1 as well as beta2-beta3 regions and the mode of recognition via switch 1 appears to be conserved among diverse Rac-specific DHR-2 GEFs
17015707 DOCK2 is needed for efficient chemokine-stimulated lymphocyte attachment to VCAM-1 under shear stress.
14737186 Nef binds the DOCK2-ELMO1 complex to activate rac and inhibit lymphocyte chemotaxis
14737186 Interaction of HIV-1 Nef with a protein complex, which includes Rac2, DOCK2, and ELMO1, activates Rac activity in T cells
12829596 the association of DOCK2 with ELMO1 is critical for DOCK2-mediated Rac activation, thereby suggesting that their association might be a therapeutic target for immunologic disorders caused by lymphocyte infiltration
12393632 DOCK2 associates with CrkL and regulates Rac1 in human leukemia cell lines
12176041 DOCK2 mediates T cell receptor-induced activation of Rac2 and IL-2 transcription in jurkat cells

AA Sequence

MAPWRKADKERHGVAIYNFQGSGAPQLSLQIGDVVRIQETCGDWYRGYLIKHKMLQGIFPKSFIHIKEVT      1 - 70
VEKRRNTENIIPAEIPLAQEVTTTLWEWGSIWKQLYVASKKERFLQVQSMMYDLMEWRSQLLSGTLPKDE     71 - 140
LKELKQKVTSKIDYGNKILELDLIVRDEDGNILDPDNTSVISLFHAHEEATDKITERIKEEMSKDQPDYA    141 - 210
MYSRISSSPTHSLYVFVRNFVCRIGEDAELFMSLYDPNKQTVISENYLVRWGSRGFPKEIEMLNNLKVVF    211 - 280
TDLGNKDLNRDKIYLICQIVRVGKMDLKDTGAKKCTQGLRRPFGVAVMDITDIIKGKAESDEEKQHFIPF    281 - 350
HPVTAENDFLHSLLGKVIASKGDSGGQGLWVTMKMLVGDIIQIRKDYPHLVDRTTVVARKLGFPEIIMPG    351 - 420
DVRNDIYITLLQGDFDKYNKTTQRNVEVIMCVCAEDGKTLPNAICVGAGDKPMNEYRSVVYYQVKQPRWM    421 - 490
ETVKVAVPIEDMQRIHLRFMFRHRSSLESKDKGEKNFAMSYVKLMKEDGTTLHDGFHDLVVLKGDSKKME    491 - 560
DASAYLTLPSYRHHVENKGATLSRSSSSVGGLSVSSRDVFSISTLVCSTKLTQNVGLLGLLKWRMKPQLL    561 - 630
QENLEKLKIVDGEEVVKFLQDTLDALFNIMMEHSQSDEYDILVFDALIYIIGLIADRKFQHFNTVLEAYI    631 - 700
QQHFSATLAYKKLMTVLKTYLDTSSRGEQCEPILRTLKALEYVFKFIVRSRTLFSQLYEGKEQMEFEESM    701 - 770
RRLFESINNLMKSQYKTTILLQVAALKYIPSVLHDVEMVFDAKLLSQLLYEFYTCIPPVKLQKQKVQSMN    771 - 840
EIVQSNLFKKQECRDILLPVITKELKELLEQKDDMQHQVLERKYCVELLNSILEVLSYQDAAFTYHHIQE    841 - 910
IMVQLLRTVNRTVITMGRDHILISHFVACMTAILNQMGDQHYSFYIETFQTSSELVDFLMETFIMFKDLI    911 - 980
GKNVYPGDWMAMSMVQNRVFLRAINKFAETMNQKFLEHTNFEFQLWNNYFHLAVAFITQDSLQLEQFSHA    981 - 1050
KYNKILNKYGDMRRLIGFSIRDMWYKLGQNKICFIPGMVGPILEMTLIPEAELRKATIPIFFDMMLCEYQ   1051 - 1120
RSGDFKKFENEIILKLDHEVEGGRGDEQYMQLLESILMECAAEHPTIAKSVENFVNLVKGLLEKLLDYRG   1121 - 1190
VMTDESKDNRMSCTVNLLNFYKDNNREEMYIRYLYKLRDLHLDCDNYTEAAYTLLLHTWLLKWSDEQCAS   1191 - 1260
QVMQTGQQHPQTHRQLKETLYETIIGYFDKGKMWEEAISLCKELAEQYEMEIFDYELLSQNLIQQAKFYE   1261 - 1330
SIMKILRPKPDYFAVGYYGQGFPSFLRNKVFIYRGKEYERREDFQMQLMTQFPNAEKMNTTSAPGDDVKN   1331 - 1400
APGQYIQCFTVQPVLDEHPRFKNKPVPDQIINFYKSNYVQRFHYSRPVRRGTVDPENEFASMWIERTSFV   1401 - 1470
TAYKLPGILRWFEVVHMSQTTISPLENAIETMSTANEKILMMINQYQSDETLPINPLSMLLNGIVDPAVM   1471 - 1540
GGFAKYEKAFFTEEYVRDHPEDQDKLTHLKDLIAWQIPFLGAGIKIHEKRVSDNLRPFHDRMEECFKNLK   1541 - 1610
MKVEKEYGVREMPDFDDRRVGRPRSMLRSYRQMSIISLASMNSDCSTPSKPTSESFDLELASPKTPRVEQ   1611 - 1680
EEPISPGSTLPEVKLRRSKKRTKRSSVVFADEKAAAESDLKRLSRKHEFMSDTNLSEHAAIPLKASVLSQ   1681 - 1750
MSFASQSMPTIPALALSVAGIPGLDEANTSPRLSQTFLQLSDGDKKTLTRKKVNQFFKTMLASKSAEEGK   1751 - 1820
QIPDSLSTDL                                                               1821 - 1830
//

Text Mined References (48)

PMID Year Title
26083206 2015 Inherited DOCK2 Deficiency in Patients with Early-Onset Invasive Infections.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
24927181 2014 Genome-wide association study identifies three novel susceptibility loci for severe Acne vulgaris.
24821968 2014 Essential role of Elmo1 in Dock2-dependent lymphocyte migration.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23911989 2013 Immune regulatory functions of DOCK family proteins in health and disease.
23525077 2013 Exome and whole-genome sequencing of esophageal adenocarcinoma identifies recurrent driver events and mutational complexity.
23382691 2013 Loci associated with N-glycosylation of human immunoglobulin G show pleiotropy with autoimmune diseases and haematological cancers.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22331897 2012 Structural basis for mutual relief of the Rac guanine nucleotide exchange factor DOCK2 and its partner ELMO1 from their autoinhibited forms.
21645150 2011 CXCL13 mediates prostate cancer cell proliferation through JNK signalling and invasion through ERK activation.
21613211 2011 Multiple factors confer specific Cdc42 and Rac protein activation by dedicator of cytokinesis (DOCK) nucleotide exchange factors.
21269460 2011 Initial characterization of the human central proteome.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20412587 2010 PI3Kp110-, Src-, FAK-dependent and DOCK2-independent migration and invasion of CXCL13-stimulated prostate cancer cells.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20350533 2010 DOCK2 regulates cell proliferation through Rac and ERK activation in B cell lymphoma.
20201926 2010 Human variation in alcohol response is influenced by variation in neuronal signaling genes.
19946888 2010 Defining the membrane proteome of NK cells.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19729484 2009 DOCK2 is a microglial specific regulator of central nervous system innate immunity found in normal and Alzheimer's disease brain.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19369195 2009 Large-scale proteomics analysis of the human kinome.
19367720 2008 Phosphorylation analysis of primary human T lymphocytes using sequential IMAC and titanium oxide enrichment.
18662984 2008 Parallel phosphatidylinositol 3-kinase (PI3K)-dependent and Src-dependent pathways lead to CXCL8-mediated Rac2 activation and chemotaxis.
18464913 2008 A genome-wide association study identifies protein quantitative trait loci (pQTLs).
18056264 2008 Specific recognition of Rac2 and Cdc42 by DOCK2 and DOCK9 guanine nucleotide exchange factors.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17015707 2006 DOCK2 is required for chemokine-promoted human T lymphocyte adhesion under shear stress mediated by the integrin alpha4beta1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15723800 2005 A Steric-inhibition model for regulation of nucleotide exchange via the Dock180 family of GEFs.
15592455 2005 Immunoaffinity profiling of tyrosine phosphorylation in cancer cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15144186 2004 Robust phosphoproteomic profiling of tyrosine phosphorylation sites from human T cells using immobilized metal affinity chromatography and tandem mass spectrometry.
14737186 2004 HIV-1 Nef binds the DOCK2-ELMO1 complex to activate rac and inhibit lymphocyte chemotaxis.
12829596 2003 DOCK2 regulates Rac activation and cytoskeletal reorganization through interaction with ELMO1.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12432077 2002 Identification of an evolutionarily conserved superfamily of DOCK180-related proteins with guanine nucleotide exchange activity.
12393632 2002 DOCK2 associates with CrkL and regulates Rac1 in human leukemia cell lines.
12191913 2002 The CDM protein DOCK2 in lymphocyte migration.
12176041 2002 DOCK2 mediates T cell receptor-induced activation of Rac2 and IL-2 transcription.
12134158 2002 Unconventional Rac-GEF activity is mediated through the Dock180-ELMO complex.
11518968 2001 Haematopoietic cell-specific CDM family protein DOCK2 is essential for lymphocyte migration.
10559471 1999 Non-adherent cell-specific expression of DOCK2, a member of the human CDM-family proteins.
9039502 1996 Prediction of the coding sequences of unidentified human genes. VI. The coding sequences of 80 new genes (KIAA0201-KIAA0280) deduced by analysis of cDNA clones from cell line KG-1 and brain.