Property Summary

NCBI Gene PubMed Count 17
PubMed Score 3.96
PubTator Score 20.28

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
adult high grade glioma -1.100 1.1e-02
astrocytic glioma -1.300 3.8e-03
Astrocytoma, Pilocytic -1.800 7.4e-07
atypical teratoid / rhabdoid tumor -1.900 1.5e-10
ependymoma -1.200 4.4e-02
glioblastoma -1.200 4.8e-05
medulloblastoma -1.400 4.1e-06
oligodendroglioma -1.500 3.6e-23
Pick disease -1.200 3.3e-03
primary pancreatic ductal adenocarcinoma -1.036 7.0e-03
primitive neuroectodermal tumor -1.200 3.0e-04

Gene RIF (6)

AA Sequence

MRGRRGDRMTINIQEHMAINVCPGPIRPIRQISDYFPRGPGPEGGGGGGGEAPAHLVPLALAPPAALLGA      1 - 70
TTPEDGAEVDSYDSDDATALGTLEFDLLYDRASCTLHCSILRAKGLKPMDFNGLADPYVKLHLLPGACKA     71 - 140
NKLKTKTQRNTLNPVWNEDLTYSGITDDDITHKVLRIAVCDEDKLSHNEFIGEIRVPLRRLKPSQKKHFN    141 - 210
ICLERQVPLASPSSMSAALRGISCYLKELEQAEQGQGLLEERGRILLSLSYSSRRRGLLVGILRCAHLAA    211 - 280
MDVNGYSDPYVKTYLRPDVDKKSKHKTCVKKKTLNPEFNEEFFYEIELSTLATKTLEVTVWDYDIGKSND    281 - 350
FIGGVSLGPGARGEARKHWSDCLQQPDAALERWHTLTSELPPAAGALSSA                        351 - 400
//

Text Mined References (18)

PMID Year Title