Property Summary

NCBI Gene PubMed Count 14
PubMed Score 3.92
PubTator Score 4.20

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
group 3 medulloblastoma 1.200 3.4e-03
non primary Sjogren syndrome sicca 1.200 2.4e-02
ovarian cancer 1.300 2.4e-04
pancreatic cancer 1.200 1.9e-06
posterior fossa group B ependymoma 1.200 1.1e-06
primary pancreatic ductal adenocarcinoma 1.573 4.1e-03

Gene RIF (5)

AA Sequence

MGATGDAEQPRGPSGAERGGLELGDAGAAGQLVLTNPWNIMIKHRQVQRRGRRSQMTTSFTDPAISMDLL      1 - 70
RAVLQPSINEEIQTVFNKYMKFFQKAALNVRDNVGEEVDAEQLIQEACRSCLEQAKLLFSDGEKVIPRLT     71 - 140
HELPGIKRGRQAEEECAHRGSPLPKKRKGRPPGHILSSDRAAAGMVWKPKSCEPIRREGPKWDPARLNES    141 - 210
TTFVLGSRANKALGMGGTRGRIYIKHPHLFKYAADPQDKHWLAEQHHMRATGGKMAYLLIEEDIRDLAAS    211 - 280
DDYRGCLDLKLEELKSFVLPSWMVEKMRKYMETLRTENEHRAVEAPPQT                         281 - 329
//

Text Mined References (20)

PMID Year Title