Property Summary

NCBI Gene PubMed Count 14
PubMed Score 3.92
PubTator Score 4.20

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
primary pancreatic ductal adenocarcinoma 1.573 4.1e-03
pancreatic cancer 1.200 1.9e-06
group 3 medulloblastoma 1.200 3.4e-03
posterior fossa group B ependymoma 1.200 1.1e-06
non primary Sjogren syndrome sicca 1.200 2.4e-02
ovarian cancer 1.300 2.4e-04

Gene RIF (5)

PMID Text
25619743 In luciferase assays, TdIF1 can up-regulate transcription activity of the promoters containing the TdIF1-binding sequences, and this effect is mainly through the palindrome 5'-TGCATG-3'.
23874396 TdIF1 associates with the RAB20 promoter, and RAB20 gene transcription is reduced in TdIF1-knocked-down cells, suggesting that TdIF1 stimulates RAB20 gene transcription.
21258344 During cell division, DNTTIP1 is part of the mitotic deacetylase complex MIDAC, which also contains C14ORF43/MIDEAS and HDAC1/HDAC2.
21258344 During cell division, DNTTIP1 forms a complex with C14ORF43/MIDEAS and HDAC1/HDAC2.
17663723 The TdT binding, DNA binding and dimerization regions, and nuclear localization signal (NLS) in TdIF1, were identified.

AA Sequence

MGATGDAEQPRGPSGAERGGLELGDAGAAGQLVLTNPWNIMIKHRQVQRRGRRSQMTTSFTDPAISMDLL      1 - 70
RAVLQPSINEEIQTVFNKYMKFFQKAALNVRDNVGEEVDAEQLIQEACRSCLEQAKLLFSDGEKVIPRLT     71 - 140
HELPGIKRGRQAEEECAHRGSPLPKKRKGRPPGHILSSDRAAAGMVWKPKSCEPIRREGPKWDPARLNES    141 - 210
TTFVLGSRANKALGMGGTRGRIYIKHPHLFKYAADPQDKHWLAEQHHMRATGGKMAYLLIEEDIRDLAAS    211 - 280
DDYRGCLDLKLEELKSFVLPSWMVEKMRKYMETLRTENEHRAVEAPPQT                         281 - 329
//

Text Mined References (20)

PMID Year Title
25653165 2015 Structural and functional characterization of a cell cycle associated HDAC1/2 complex reveals the structural basis for complex assembly and nucleosome targeting.
25619743 2015 Definition of the transcription factor TdIF1 consensus-binding sequence through genomewide mapping of its binding sites.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23874396 2013 TdIF1 recognizes a specific DNA sequence through its Helix-Turn-Helix and AT-hook motifs to regulate gene transcription.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21573134 2011 Nuclear cGMP-dependent kinase regulates gene expression via activity-dependent recruitment of a conserved histone deacetylase complex.
21258344 2011 Chemoproteomics profiling of HDAC inhibitors reveals selective targeting of HDAC complexes.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17663723 2007 Identification of functional domains in TdIF1 and its inhibitory mechanism for TdT activity.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16371131 2006 Direct binding of TReP-132 with TdT results in reduction of TdT activity.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12766061 2003 Gene expression profile of the human trabecular meshwork: NEIBank sequence tag analysis.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
11473582 2001 Terminal deoxynucleotidyltransferase directly interacts with a novel nuclear protein that is homologous to p65.