Property Summary

NCBI Gene PubMed Count 19
PubMed Score 171.68
PubTator Score 11.62

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
posterior fossa group B ependymoma 1530 6.5e-07
ovarian cancer 8491 1.5e-05
lung cancer 4473 8.4e-05
psoriasis 6685 2.2e-04
Disease Target Count Z-score Confidence
Root caries 4 3.383 1.7

Expression

  Differential Expression (4)

Disease log2 FC p
psoriasis 1.300 2.2e-04
posterior fossa group B ependymoma 1.700 6.5e-07
lung cancer 1.600 8.4e-05
ovarian cancer 1.500 1.5e-05

Gene RIF (2)

PMID Text
20962348 analysis of human deoxynucleotide N-hydrolase Rcl and rat gene c6orf108
18726892 characterization of the human Rcl gene, we cloned its promoter, Rcl is a bona fide target gene of ETV1.

AA Sequence

MAAAMVPGRSESWERGEPGRPALYFCGSIRGGREDRTLYERIVSRLRRFGTVLTEHVAAAELGARGEEAA      1 - 70
GGDRLIHEQDLEWLQQADVVVAEVTQPSLGVGYELGRAVAFNKRILCLFRPQSGRVLSAMIRGAADGSRF     71 - 140
QVWDYEEGEVEALLDRYFEADPPGQVAASPDPTT                                        141 - 174
//

Text Mined References (31)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
25108359 2014 6-(Hetero)Arylpurine nucleotides as inhibitors of the oncogenic target DNPH1: synthesis, structural studies and cytotoxic activities.
24324551 2013 Genome wide association study (GWAS) of Chagas cardiomyopathy in Trypanosoma cruzi seropositive subjects.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24260472 2013 N (6)-substituted AMPs inhibit mammalian deoxynucleotide N-hydrolase DNPH1.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21492153 2011 Analysis of proteomic changes induced upon cellular differentiation of the human intestinal cell line Caco-2.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
21044950 2011 Genome-wide YFP fluorescence complementation screen identifies new regulators for telomere signaling in human cells.
20962348 2010 Probing the active site of the deoxynucleotide N-hydrolase Rcl encoded by the rat gene c6orf108.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18726892 2008 Rcl is a novel ETV1/ER81 target gene upregulated in breast tumors.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17234634 2007 The c-Myc target gene Rcl (C6orf108) encodes a novel enzyme, deoxynucleoside 5'-monophosphate N-glycosidase.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16341674 2005 Transcriptome analysis of human gastric cancer.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9271375 1997 Identification of putative c-Myc-responsive genes: characterization of rcl, a novel growth-related gene.