Property Summary

Ligand Count 2
NCBI Gene PubMed Count 19
PubMed Score 184.21
PubTator Score 11.62

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ependymoma 4679 4.3e-05
psoriasis 6694 2.2e-04
ovarian cancer 8520 5.5e-04
lung cancer 4740 2.2e-03
Disease Target Count Z-score Confidence
Amelogenesis imperfecta type 3 6 3.567 1.8
Root caries 4 3.33 1.7

Expression

  Differential Expression (4)

Disease log2 FC p
ependymoma 1.200 4.3e-05
lung cancer 1.300 2.2e-03
ovarian cancer 1.400 5.5e-04
psoriasis 1.300 2.2e-04

Gene RIF (2)

AA Sequence

MAAAMVPGRSESWERGEPGRPALYFCGSIRGGREDRTLYERIVSRLRRFGTVLTEHVAAAELGARGEEAA      1 - 70
GGDRLIHEQDLEWLQQADVVVAEVTQPSLGVGYELGRAVAFNKRILCLFRPQSGRVLSAMIRGAADGSRF     71 - 140
QVWDYEEGEVEALLDRYFEADPPGQVAASPDPTT                                        141 - 174
//

Text Mined References (31)

PMID Year Title