Property Summary

NCBI Gene PubMed Count 19
PubMed Score 31.98
PubTator Score 9.85

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (3)

Disease log2 FC p
medulloblastoma, large-cell 1.400 1.3e-03
adult high grade glioma 1.100 2.5e-03
ovarian cancer 1.400 5.1e-05

Protein-protein Interaction (1)

Gene RIF (3)

PMID Text
23948443 aspartyl aminopeptidase was upregulated in colorectal cancer tissues, and greater activity correlated significantly with the absence of lymph node metastases and with better overall survival
22720794 The crystal structure of human DNPEP complexed with zinc and a substrate analogue aspartate-beta-hydroxamate reveals a dodecameric machinery built by domain-swapped dimers.
12413488 Identification of histidine residues important in the catalysis and structure of aspartyl aminopeptidase

AA Sequence

MQVAMNGKARKEAVQTAAKELLKFVNRSPSPFHAVAECRNRLLQAGFSELKETEKWNIKPESKYFMTRNS      1 - 70
STIIAFAVGGQYVPGNGFSLIGAHTDSPCLRVKRRSRRSQVGFQQVGVETYGGGIWSTWFDRDLTLAGRV     71 - 140
IVKCPTSGRLEQQLVHVERPILRIPHLAIHLQRNINENFGPNTEMHLVPILATAIQEELEKGTPEPGPLN    141 - 210
AVDERHHSVLMSLLCAHLGLSPKDIVEMELCLADTQPAVLGGAYDEFIFAPRLDNLHSCFCALQALIDSC    211 - 280
AGPGSLATEPHVRMVTLYDNEEVGSESAQGAQSLLTELVLRRISASCQHPTAFEEAIPKSFMISADMAHA    281 - 350
VHPNYLDKHEENHRPLFHKGPVIKVNSKQRYASNAVSEALIREVANKVKVPLQDLMVRNDTPCGTTIGPI    351 - 420
LASRLGLRVLDLGSPQLAMHSIREMACTTGVLQTLTLFKGFFELFPSLSHNLLVD                   421 - 475
//

Text Mined References (23)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25164821 2014 Short forms of Ste20-related proline/alanine-rich kinase (SPAK) in the kidney are created by aspartyl aminopeptidase (Dnpep)-mediated proteolytic cleavage.
24913940 2014 Identification and characterization of novel inhibitors of Mammalian aspartyl aminopeptidase.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23948443 2013 Clinical impact of aspartyl aminopeptidase expression and activity in colorectal cancer.
23740937 2013 A systemic sclerosis and systemic lupus erythematosus pan-meta-GWAS reveals new shared susceptibility loci.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22720794 2012 Structure of human aspartyl aminopeptidase complexed with substrate analogue: insight into catalytic mechanism, substrate specificity and M18 peptidase family.
22516433 2012 Proteomic analysis of microvesicles from plasma of healthy donors reveals high individual variability.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21269460 2011 Initial characterization of the human central proteome.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12895663 2003 Angiotensinase activities in the kidney of renovascular hypertensive rats.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12413488 2002 Identification of histidine residues important in the catalysis and structure of aspartyl aminopeptidase.
9632644 1998 Purification, characterization, and cloning of a cytosolic aspartyl aminopeptidase.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.