Property Summary

NCBI Gene PubMed Count 41
PubMed Score 83.55
PubTator Score 58.05

Knowledge Summary

Patent

No data available

Expression

Gene RIF (29)

PMID Text
26647998 the present study has demonstrated that variations in the DNMT3L gene do not contribute to stage I-II endometriosis-associated infertility.
25383530 crystal structures of DNMT3A-DNMT3L (autoinhibitory form) and DNMT3A-DNMT3L-H3 (active form) complexes at 3.82 and 2.90 A resolution, respectively
24952347 DNMT3L can address DNMT3A/B to specific sites by directly interacting with TFs that do not directly interact with DNMT3A/B
24859147 DNMT3L rs2070565 (genotype P = 0.007, allele P = 0.0026) confers an increased risk of developing schizophrenia at an early age in individuals with family history.
24743422 CpG island encompassing the promoter and first exon of human DNMT3L gene is a PcG/TrX response element
22671959 DNMT3L is one of the key players in de novo DNA methylation of imprinting control elements and retrotransposons, which occurs after genome-wide epigenetic erasure during germ cell development. (Review)
22401780 Genetic polymorphisms of DNMT3L involved in hypermethylation of chromosomal ends are associated with greater risk of developing ovarian endometriosis.
22116073 SNP rs2070565, as well as haplotypes AAA and GAA, may be associated with male infertility; DNMT3L may contribute to azoospermia susceptibility in humans
21126912 mutation analysis of SYCP3, DNMT3L and MSH4 in patients with maturation arrest of spermatogenesis and couples with recurrent miscarriages.
20838592 This study offers insights into the manner by which DNA methylation patterns are deposited and reveals a new level of interplay between members of the de novo DNMT family.
20670142 We have identified loss of methylation at the DNMT3L promoter in ocular surface squamous neoplasia cases.
20630873 Processive methylation is enhanced 3-fold in the presence of DNMT3L, an inactive homolog of DNMT3A, therefore providing a mechanism for the previously described DNMT3L activation of DNMT3A.
20593030 Observational study of gene-disease association. (HuGE Navigator)
20460473 DNMT3L is a novel marker and is essential for the growth of human embryonal carcinoma.
20428781 DNMT3L exerts a major effect on the transcriptional regulation of a specific target gene, such as thymine DNA glycosylase
19921333 CG dinucleotide recognized by the Dnmt3a and Dnmt3L complex are distinctive at retroelements and imprinted domains.
19625766 Overexpression of DNMT3L, which functions by regulating the activity of DNMT3A and DNMT3B, increased cellular proliferation and anchorage-independent growth.
19246518 DNMT3L(R271Q) is impaired in its ability to stimulate de novo DNA methylation by DNMT3A.
19246518 Observational study of gene-disease association. (HuGE Navigator)
19064572 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
17965599 Importance of DNA methylation profile at DNMT3L promoter not only as a promising biomarker for cervical cancer but also provides insight into the possible role of DNMT3L in cancer development.
17713477 the carboxy-terminal domain of human Dnmt3L interacts with the catalytic domain of Dnmt3a, demonstrating that Dnmt3L has dual functions of binding the unmethylated histone tail and activating DNA methyltransferase
17687327 Crystallographic studies of human DNMT3L showed that the protein has a carboxy-terminal methyltransferase-like domain and an N-terminal cysteine-rich domain
16829525 Data show that binding of DNMT3L to DNMT3A2 promotes reorganization of DNMT3A2 subunits and leads to formation of specific complexes with enhanced DNA methyltransferase activity and increased S-adenosyl-L-methionine binding.
16575165 The acquisition of DNMT3L by a common ancestor of eutherians and marsupials might have been closely related to the evolution of imprinting.
16543361 Dnmt3L-Dnmt3b interactions play an important role in the regulation of DNA methylation during mammalian development.
16211598 Regulates germ cell-specific gene expression and intracisternal A-particle suppression, which are critical for male germ cell proliferation and meiosis.
15105426 The carboxyl-terminal half of DNMT3L was found to be responsible for the stimulation of the DNA methylation activity of Dnmt3a and Dnmt3b.
12481029 DNMT3L stimulates de novo methylation by Dnmt3a.

AA Sequence

MAAIPALDPEAEPSMDVILVGSSELSSSVSPGTGRDLIAYEVKANQRNIEDICICCGSLQVHTQHPLFEG      1 - 70
GICAPCKDKFLDALFLYDDDGYQSYCSICCSGETLLICGNPDCTRCYCFECVDSLVGPGTSGKVHAMSNW     71 - 140
VCYLCLPSSRSGLLQRRRKWRSQLKAFYDRESENPLEMFETVPVWRRQPVRVLSLFEDIKKELTSLGFLE    141 - 210
SGSDPGQLKHVVDVTDTVRKDVEEWGPFDLVYGATPPLGHTCDRPPSWYLFQFHRLLQYARPKPGSPRPF    211 - 280
FWMFVDNLVLNKEDLDVASRFLEMEPVTIPDVHGGSLQNAVRVWSNIPAIRSRHWALVSEEELSLLAQNK    281 - 350
QSSKLAAKWPTKLVKNCFLPLREYFKYFSTELTSSL                                      351 - 386
//

Text Mined References (41)

PMID Year Title
26647998 2016 Association between DNMT3L polymorphic variants and the risk of endometriosis-associated infertility.
25416956 2014 A proteome-scale map of the human interactome network.
25383530 2015 Structural insight into autoinhibition and histone H3-induced activation of DNMT3A.
24952347 2014 DNMT3L interacts with transcription factors to target DNMT3L/DNMT3B to specific DNA sequences: role of the DNMT3L/DNMT3B/p65-NF?B complex in the (de-)methylation of TRAF1.
24859147 2014 DNA methyl transferase (DNMT) gene polymorphisms could be a primary event in epigenetic susceptibility to schizophrenia.
24743422 2014 The CpG island encompassing the promoter and first exon of human DNMT3L gene is a PcG/TrX response element (PRE).
22671959 2012 Functions of DNA methyltransferase 3-like in germ cells and beyond.
22401780 2012 Genetic polymorphisms of DNMT3L involved in hypermethylation of chromosomal ends are associated with greater risk of developing ovarian endometriosis.
22116073 2012 Association between single-nucleotide polymorphisms of DNMT3L and infertility with azoospermia in Chinese men.
21126912 2011 Mutation analysis of three genes in patients with maturation arrest of spermatogenesis and couples with recurrent miscarriages.
20838592 2010 DNMT3L modulates significant and distinct flanking sequence preference for DNA methylation by DNMT3A and DNMT3B in vivo.
20670142 2010 Hypomethylation of the DNMT3L promoter in ocular surface squamous neoplasia.
20630873 2010 The inherent processivity of the human de novo methyltransferase 3A (DNMT3A) is enhanced by DNMT3L.
20593030 2010 Human intelligence and polymorphisms in the DNA methyltransferase genes involved in epigenetic marking.
20460473 2010 DNMT3L is a novel marker and is essential for the growth of human embryonal carcinoma.
20428781 2010 DNA methyltransferase 3-like affects promoter methylation of thymine DNA glycosylase independently of DNMT1 and DNMT3B in cancer cells.
19921333 CG dinucleotide periodicities recognized by the Dnmt3a-Dnmt3L complex are distinctive at retroelements and imprinted domains.
19625766 2009 Reprogramming of HeLa cells upon DNMT3L overexpression mimics carcinogenesis.
19246518 2009 A systematic search for DNA methyltransferase polymorphisms reveals a rare DNMT3L variant associated with subtelomeric hypomethylation.
19064572 2008 Polymorphism in the IL18 gene and epithelial ovarian cancer in non-Hispanic white women.
17965599 DNA methylation profile at the DNMT3L promoter: a potential biomarker for cervical cancer.
17713477 2007 Structure of Dnmt3a bound to Dnmt3L suggests a model for de novo DNA methylation.
17687327 2007 DNMT3L connects unmethylated lysine 4 of histone H3 to de novo methylation of DNA.
16829525 2006 Reconstitution and mechanism of the stimulation of de novo methylation by human DNMT3L.
16780588 2006 Cell array-based intracellular localization screening reveals novel functional features of human chromosome 21 proteins.
16575165 2006 Evolution of the vertebrate DNMT3 gene family: a possible link between existence of DNMT3L and genomic imprinting.
16543361 2006 Mutations in DNA methyltransferase DNMT3B in ICF syndrome affect its regulation by DNMT3L.
16211598 2006 Meiotic and epigenetic aberrations in Dnmt3L-deficient male germ cells.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15105426 2004 DNMT3L stimulates the DNA methylation activity of Dnmt3a and Dnmt3b through a direct interaction.
14735494 2004 Expression of mRNAs for DNA methyltransferases and methyl-CpG-binding proteins in the human female germ line, preimplantation embryos, and embryonic stem cells.
12481029 2002 The DNA methyltransferase-like protein DNMT3L stimulates de novo methylation by Dnmt3a.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12237941 2002 Genomic imprinting and epigenetic reprogramming: unearthing the garden of forking paths.
12202768 2002 Dnmt3L is a transcriptional repressor that recruits histone deacetylase.
12177302 2002 Imprinting regulator DNMT3L is a transcriptional repressor associated with histone deacetylase activity.
12044346 2002 DNA methyltransferases get connected to chromatin.
11934864 2002 Dnmt3L cooperates with the Dnmt3 family of de novo DNA methyltransferases to establish maternal imprints in mice.
10857753 2000 Isolation and initial characterization of a novel zinc finger gene, DNMT3L, on 21q22.3, related to the cytosine-5-methyltransferase 3 gene family.
10830953 2000 The DNA sequence of human chromosome 21.