Property Summary

Ligand Count 3
NCBI Gene PubMed Count 308
PubMed Score 722.75
PubTator Score 435.84

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Disease Target Count Z-score Confidence
Crohn's disease 321 0.0 3.0

Expression

  Differential Expression (16)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 2.200 1.6e-11
Breast cancer 1.200 2.8e-13
ductal carcinoma in situ 1.200 6.3e-04
ependymoma -1.300 2.5e-03
glioblastoma 1.500 4.5e-07
group 3 medulloblastoma 2.400 4.2e-04
intraductal papillary-mucinous neoplasm ... 1.100 2.1e-02
invasive ductal carcinoma 1.500 4.6e-03
lung cancer 1.400 3.1e-02
malignant mesothelioma 2.400 4.2e-07
medulloblastoma, large-cell 2.700 4.5e-07
non-small cell lung cancer 1.272 4.3e-20
oligodendroglioma -1.200 1.2e-03
osteosarcoma -1.677 3.8e-03
pediatric high grade glioma 1.600 5.7e-06
primitive neuroectodermal tumor 2.500 6.1e-05

Protein-protein Interaction (3)

Gene RIF (283)

AA Sequence

MPAMPSSGPGDTSSSAAEREEDRKDGEEQEEPRGKEERQEPSTTARKVGRPGRKRKHPPVESGDTPKDPA      1 - 70
VISKSPSMAQDSGASELLPNGDLEKRSEPQPEEGSPAGGQKGGAPAEGEGAAETLPEASRAVENGCCTPK     71 - 140
EGRGAPAEAGKEQKETNIESMKMEGSRGRLRGGLGWESSLRQRPMPRLTFQAGDPYYISKRKRDEWLARW    141 - 210
KREAEKKAKVIAGMNAVEENQGPGESQKVEEASPPAVQQPTDPASPTVATTPEPVGSDAGDKNATKAGDD    211 - 280
EPEYEDGRGFGIGELVWGKLRGFSWWPGRIVSWWMTGRSRAAEGTRWVMWFGDGKFSVVCVEKLMPLSSF    281 - 350
CSAFHQATYNKQPMYRKAIYEVLQVASSRAGKLFPVCHDSDESDTAKAVEVQNKPMIEWALGGFQPSGPK    351 - 420
GLEPPEEEKNPYKEVYTDMWVEPEAAAYAPPPPAKKPRKSTAEKPKVKEIIDERTRERLVYEVRQKCRNI    421 - 490
EDICISCGSLNVTLEHPLFVGGMCQNCKNCFLECAYQYDDDGYQSYCTICCGGREVLMCGNNNCCRCFCV    491 - 560
ECVDLLVGPGAAQAAIKEDPWNCYMCGHKGTYGLLRRREDWPSRLQMFFANNHDQEFDPPKVYPPVPAEK    561 - 630
RKPIRVLSLFDGIATGLLVLKDLGIQVDRYIASEVCEDSITVGMVRHQGKIMYVGDVRSVTQKHIQEWGP    631 - 700
FDLVIGGSPCNDLSIVNPARKGLYEGTGRLFFEFYRLLHDARPKEGDDRPFFWLFENVVAMGVSDKRDIS    701 - 770
RFLESNPVMIDAKEVSAAHRARYFWGNLPGMNRPLASTVNDKLELQECLEHGRIAKFSKVRTITTRSNSI    771 - 840
KQGKDQHFPVFMNEKEDILWCTEMERVFGFPVHYTDVSNMSRLARQRLLGRSWSVPVIRHLFAPLKEYFA    841 - 910
CV                                                                        911 - 912
//

Text Mined References (320)

PMID Year Title