Property Summary

NCBI Gene PubMed Count 156
PubMed Score 396.60
PubTator Score 237.39

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
hereditary spastic paraplegia -1.034 1.1e-02
lung cancer 1.200 9.4e-04

Gene RIF (117)

PMID Text
26915633 Haploinsufficiency of Drp1 abolished mitochondrial autophagy and exacerbated the development of heart failure.
26903540 The results indicate that Drp1-dependent mitochondrial fission through MiD49/MiD51 regulates cristae remodeling during intrinsic apoptosis.
26825290 DNM1L has a critical role in regulating mitochondrial morphology and function [case report of two siblings]
26812016 that KIF1Bbeta affects mitochondrial dynamics through calcineurin-dependent dephosphorylation of Dynamin-related protein 1 (DRP1), causing mitochondrial fission and apoptosis
26609810 Drp1 is in dynamic equilibrium on mitochondria in a fission-independent manner, and that fission factors such as actin filaments target productive oligomerization to fission sites.
26598294 Dynamin-related protein 1 (Dpr1) activates mitochondrial-dependent apoptosis and indicate that inhibiting Dpr1 function can protect against chlorpyrifos-induced cytotoxicity.
26578513 membrane-anchored Mff differentially regulates various Drp1 isoforms.
26577411 These findings provide new insights into the role of the Drp1-dependent mitochondrial pathway in the pathology of osteoporosis.
26518267 In neuroblastoma cells, hnRNP A1 directly interacts with Drp1 mRNA at its 3'UTR region, and enhances translation potential without affecting mRNA stability.
26384664 Activation of apoptosis triggers MAPL/MUL1-dependent SUMOylation of the fission GTPase Drp1, a process requisite for cytochrome c release.
26381214 Results identify a crucial role for RIPK3-PGAM5-Drp1/NFAT signalling in NKT cell activation, and further suggest that RIPK3-PGAM5 signalling may mediate crosstalk between mitochondrial function and immune signalling.
26358295 Data show that mitochondrial protein ccdc56/MITRAC12/COA3 positively regulates mitochondrial fission by recruiting the fission factor Drp1.
26356820 Results indicate that a multiprotein complex including PGAM5, Bax and Drp1 proteins specifically formed during intrinsic apoptosis induction.
26114658 liensinine sensitizes breast cancer cells to chemotherapy through DNM1L-mediated mitochondrial fission
26093086 Dindings demonstrate for the first time, that Drp1 is required for Bax mitochondrial translocation, but Drp1-induced mitochondrial fragmentation alone is not sufficient to induce apoptosis in DLBCL cells.
25822260 Data indicate that mitochondrial fission proteins Drp1 and Fis1 are overexpressed in oncocytic cell tumors, and that Drp1 expression levels correlates with cell tumor malignancy ex vivo and with migration ability.
25770210 the ability of full-length Drp1 to constrict lipid bilayers through a GTP hydrolysis-dependent mechanism
25659608 The role of the mitochondrial fission protein Dynamin-related protein 1 (Drp1) in apoptosis during reperfusion injury. [Review]
25658205 Data suggest that induction of mitochondrial fission through phosphorylation of Drp1 is a critical event in tumor growth driven by Ras or MAPK.
25658204 Results show that DRP1-dependent mitochondrial division is a crucial regulator of RAS-induced transformation.
25487648 BIN1/M-Amphiphysin2 induces clustering of phosphoinositides to recruit its downstream partner dynamin
25482923 results suggest that astrocytic mitochondrial Dlp1 is a key protein in mitochondrial dynamics and decreased Dlp1 may interfere with neuron survival in PD by disrupting Ca(2+)-coupled glutamate uptake.
25446129 enhanced efficacy of combination of mdivi-1 and death ligands is not dependent on the originally reported target of mdivi-1, Drp1, and is also not dependent on the two important pro-apoptotic Bcl-2 family proteins Bax and Bak
25332205 Disruption of Drp1 induces mitochondrial elongation, inhibits mitochondrial autophagy, and causes mitochondrial dysfunction.
25326752 our results reveal a specific role for the RIP1-RIP3-DRP1 pathway in RNA virus-induced activation of the NLRP3 inflammasome
25320323 Knockdown of DRP1 by siRNA reduces mitochondria polarization in HIV-1 infected T cells to the Gag-accumulated virological synapse contact site
25284615 Data indicate that MiR-30a inhibited dynamin-related protein-1 (Drp-1) expression.
25174275 silencing of Drp1 expression also caused mitochondrial hyperfusion and sensitized cancer cells to TRAIL-induced apoptosis
25082190 Dnm1L interacts with KLC1 through the tetratricopeptide repeat domains.
24947026 Reductions in Drp1 Ser(616) phosphorylation were negatively correlated with increases in fat oxidation.
24899388 Study indicates the involvement of Drp1 in hypoxia-induced migration of human glioblastoma U251 cells.
24790094 DRP1 dimers, and not multimers, potentiate the reassembly and reorganization of Drp1 for mitochondrial membrane remodeling both in vitro and in vivo.
24755420 Overall these results suggest that Drp1 and the mitochondria play important roles during Shigella infection.
24681098 Upon stimulation Drp1 is S-nitrosylated, which is required for oxidative signalling in T cells.
24634514 Mitochondria that use oxidative phosphorylation are protected from damage-induced fission through the impaired recruitment and activation of mitochondrial DRP1.
24489003 Knockdown of DRP1 by siRNA reduces mitochondria polarization in HIV-1 infected T cells to the Gag-accumulated virological synapse contact site
24302731 Mitochondrial remodeling was associated with increased proximity between Rab11a and mitochondrial membranes, changes in fusion-fission dynamics, and mitochondrial relocalization of the Drp1, which was regulated by the Rab11a effector protein FIP1/RCP.
24252614 Results indicate that mitochondrial dysfunction resulting from changes in the ERK1/2-fission/fusion dynamin-like protein (DLP1) machinery and signaling pathway.
24206264 findings indicate that once fibroblast cells are primed for death, Drp1 is not required for apoptosis. However, Drp1 may contribute to ABT-737-induced respiratory changes and the kinetics of cytochrome c release.
24121705 Cadmium induces mitochondrial loss via the overactivation of mitophagy following DNM1L-dependent mitochondrial fragmentation.
24080278 mitochondrial fragmentation or fission was associated with increased expression of the dynamin-like protein DRP1, which promotes mitochondrial fission.
23977156 X-ray crystal structure of human DNM1L reveals details of the GTPase domain catalytic mechanism.
23921378 MiD49 and MiD51 can act independently of Mff and Fis1 in Drp1 recruitment and suggest that they provide specificity to the division of mitochondria.
23713734 In a transgenic mouse model of amyotrophic lateral sclerosis, Drp1 is significantly increased in spinal cord.
23641925 S-nitrosylation of dynamin-related protein 1 mediates mutant huntingtin-induced mitochondrial fragmentation and neuronal injury in Huntington's disease.
23584531 An oligomerization mode for DNM1L which differs from that of dynamin and might be adapted to the remodelling of mitochondria.
23524851 In a novel adaptive pathway to extreme cell stress, dynamic changes in SENP3 stability and regulation of Drp1 SUMOylation are crucial determinants of cell fate.
23334860 Dynamin-related protein 1 (Drp1) plays a role in mitochondrial fission in oxygen sensing and constriction of the ductus arteriosus.
23288151 Results demonstrate that inhibition of Drp1 disrupts platelet fusion pore dynamics and indicate that Drp1 can be targeted to control thrombus formation in vivo.
23284813 TRAP1 controls mitochondrial fusion/fission balance through Drp1 and Mff expression.
23185298 GSK3beta-mediated phosphorylation at Ser693 of Drp1 may be associated with mitochondrial elongation.
23028930 Defects in mitochondrial fission protein dynamin-related protein 1 are linked to apoptotic resistance and autophagy in a lung cancer mode.
23027751 Initial X-ray diffraction experiments of DRP1 yielded data to 2.67 A resolution
22955947 Results show that SOCS6 forms complex with DRP1 and the mitochondrial phosphatase PGAM5, attenuates DRP1 phosphorylation, and promotes DRP1 mitochondrial translocation.
22745122 O-GlcNAcylation modulates DRP1 functionality in cardiac muscle cells.
22595283 Data show that elevated DnaJA3 induces dynamin-related protein 1 (Drp1)-depedendent mitochondrial fragmentation and decreased cell viability.
22583914 Data indicate that PPP2R2B gene product PP2A/Bbeta2 activates the mitochondrial fission enzyme dynamin-related protein 1 (Drp1) by dephosphorylating Ser656.
22511751 DRP-1-mediated mitotic fission is a cell-cycle checkpoint that can be therapeutically targeted in hyperproliferative disorders such as pulmonary arterial hypertension.
22487795 mitochondrial fission factor DRP1 inhibits colon cancer cell apoptosis through the regulation of cytochrome c release and mitochondrial membrane integrity.
22445325 This study demonstrated that SNCA overexpression not only altered mitochondrial morphology, but also significantly increased the translocation of mitochondrial fission protein dynamin-like protein 1 (DLP1).
22438978 Knockdown of DRP1 by siRNA reduces mitochondria polarization in HIV-1 infected T cells to the Gag-accumulated virological synapse contact site
22428580 these studies suggest that DJ-1 is involved in the regulation of mitochondrial dynamics through modulation of DLP1 expression
22367970 Abnormal interaction between the mitochondrial fission protein Drp1 and hyperphosphorylated tau in Alzheimer's disease neurons
22340708 Altered mitochondrial fission proteins Drp1 and mitochondrial outer membrane fission (Fis)1 are relatively sensitive and specific in patients with Alzheimer's disease.
22228096 LRRK2 regulates mitochondrial dynamics in neurons by increasing mitochondrial DLP1 through its direct interaction with DLP1, and LRRK2 kinase activity plays a critical role in this process.
22020994 ER-specific BNIP1 plays an important role in mitochondrial dynamics by modulating the mitochondrial fission protein Drp1
22005465 Knocking down of Drp1 expression prevented radiation induced acceleration of mitochondrial fission. Furthermore, knockdown of Drp1 significantly suppressed delayed production of mitochondrial O(2)(-).
21997870 mutant Htt interacts with Drp1, elevates GTPase Drp1 enzymatic activity, increases abnormal mitochondrial dynamics and results in defective anterograde mitochondrial movement and synaptic deficiencies
21956116 Knockdown of DRP1 by siRNA reduces mitochondria polarization in HIV-1 infected T cells to the Gag-accumulated virological synapse contact site
21903925 Data show that Inhibition of Drp1-induced mitochondrial fission within VacA-intoxicated cells inhibited the activation of the proapoptotic Bcl-2-associated X (Bax) protein, permeabilization of the mitochondrial outer membrane, and cell death.
21840923 The middle domain mutations G350D and R365S, and DeltaPH affect GTPase activity, but have no significant impact on protein tetrameric state and liposome-binding properties.
21816823 Knockdown of DRP1 by siRNA reduces mitochondria polarization in HIV-1 infected T cells to the Gag-accumulated virological synapse contact site
21701560 elevated MIEF1 levels induce mitochondrial fusion; depletion of MIEF1 causes mitochondrial fragmentation; MIEF1 interacts with and recruits Drp1 to mitochondria but inhibits Drp1 activity, executing a negative effect on mitochondrial fission
21615675 Neurotoxin 1-methyl-4-phenylpyridinium induced changes in DLP1 expression and mitochondrial fragmentation.
21459773 in patients with AD, increased production of Abeta and the interaction of Abeta with Drp1 are crucial factors in mitochondrial fragmentation, abnormal mitochondrial dynamics and synaptic damage.
21336284 Mutant huntingtin abnormally interacts with the mitochondrial fission GTPase dynamin-related protein-1 (DRP1) in mice and humans with Huntington's disease, which, in turn, stimulates its enzymatic activity
21325626 Changes in mitochondrial dynamics as cells exit mitosis are driven in part through ubiquityla nottion of dynamin 1-like protein ,Drp1, catalyzed by the anaphase-promoting complex/cyclosome and its coactivator Cdh1E3-ubiquitin ligase complex.
21292769 Drp1 as a novel substrate of Parkin and suggest a potential mechanism linking abnormal Parkin expression to mitochondrial dysfunction in the pathogenesis of Parkinson disease.
21172823 Endophilin and dynamin colocalize at the base of the clathrin coat.
21145355 Mutant proteins of neurodegenerative diseases interact with Drp1, activate mitochondrial fission machinery, fragment mitochondria excessively, and impair mitochondrial transport and mitochondrial dynamics.
20850011 Using a minimal cell-free assay study identified Drp1 as a protein capable of stimulating oligomerization of Bax upon its insertion into liposomes and provides evidence that Drp1 stimulates Bax oligomerization by promoting membrane remodeling.
20696759 Data suggest that the Drp1 A395D lethal defect likely resulted in impaired higher order assembly of Drp1 at mitochondria, leading to decreased fission, elongated mitochondria, and altered cellular distribution of mitochondria.
20683914 Data suggest that Bax activation is not essential for mitochondrial outer membrane permeabilization but essential for Drp1-mediated mitochondrial fission during the apoptosis caused by Photofrin-PDT.
20649536 Drp1 has a role in dynamic regulation of mitochondrial fission [review]
20467441 inhibition of mitochondrial fission, with the consequent formation of a mitochondrial network, is required for myogenic differentiation and is dependent on inhibition of Drp1 function. also, nitric oxide inhibits Drp1-dependent mitochondrial fission
20428767 we observed that increasing mitochondrial calcium induced mitochondrial fragmentation, which correlated with the presence of Drp1
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20179104 There is a Drp1- and Fis1-induced, and PINK1-mediated protection mechanism in senescent cells.
20103533 lack of MARCH5 results in mitochondrial elongation, which promotes cellular senescence by blocking Drp1 activity and/or promoting accumulation of Mfn1 at the mitochondria
19525928 Nuclear DRP1 is highly expressed in lung adenocarcinomas, and correlates with poor prognosis.
19492085 Drp1 is dephosphorylated in PINK1 deficient cells due to activation of the calcium-dependent phosphatase calcineurin.
19409380 Results suggest that Drp1 appears to affect the activity of the mitochondrial fusion machinery by unbalancing the protein levels of mitofusins and OPA1.
19342591 study found nitric oxide produced in response to beta-amyloid protein triggered mitochondrial fission & neuronal damage, in part by S-nitrosylation of drp1; SNO-Drp1 is increased in Alzheimer disease patients brains
19074440 DLP1 also caused global morphological changes in mitochondrial outer membrane-like liposomes, but DLP1 did not stimulate BAX-permeabilizing function in the absence or presence of Bif-1.
18838687 fragmentation of depolarized mitochondria depends on a loop involving sustained Ca(2+) rise, activation of calcineurin, and dephosphorylation of Drp1 and its translocation to the organelle
18695047 CaMKIalpha is a widely expressed protein kinase, suggesting that Ca2+ is likely to be functionally important in the control of mitochondrial dynamics through regulation of Drp1 phosphorylation in neurons and other cell types.
18599615 DLP1 reduction causes mitochondrial abnormalities in sAD fibroblasts, elevated oxidative stress and increased amyloid beta production are likely the potential pathogenic factors that cause DLP1 reduction and abnormal mitochondrial distribution
18465792 review of the regulation, activity, and function of dynamin-related protein 1, the main factor for controlled mitochondrial fission [review]
17906671 Drp1 dephosphorylation increases cell vulnerability to apoptosis.
17721437 Reversible phosphorylation of Drp1 by cyclic AMP-dependent protein kinase and calcineurin regulates mitochondrial fission and cell death.
17718388 Precise interactions between a few proteins are required for mitochondrial fusion and division. Among them Drp1, Mfn1, Mfn2 and Opal are considered the most important.
17682056 Results show that Drp1 mediates caspase-independent type III cell death in normal and leukemic cells.
17606867 MARCH5 is required for DRP1-dependent mitochondrial division.
17553808 Protein phosphorylation at Ser(637) results in clear alterations in Drp1 function and mitochondrial morphology.
17332775 Dnregulation of Drp1 delays but does not inhibit apoptosis, suggesting that mitochondrial fragmentation is not a prerequisite for apoptosis.
17301055 phosphorylation of Drp1 on Ser-585 promotes mitochondrial fission in mitotic cells
16010987 Drp1 together with mitochondrial fission protein (hFis1) antogonizes Bcl-2.
15824135 Early regulatory GTPase-like function of dynamin precedes late, assembly-dependent steps during which GTP hydrolysis is required for vesicle release.
15791210 Data show that BIK activates recruitment of DRP1 to the surface of the endoplasmic reticulum in intact cells, resulting in mitochondrial fragmentation but little release of cytochrome c to the cytosol.
15364948 GTPase domain of DLP1 provides an enzymatic function, other domains contain information for assembly and mitochondrial targeting
15356267 Fis1, Drp1, and Opa1 have roles in apoptosis
14741701 Minimal HdynIV promoter has been characterized and shown that CTCCCAGCA (-108 to -100) sequence may act as a novel transcriptional element for regulating HdynIV gene expression.
12861026 DLP1 has a role in mitochondrial fission through an interaction with hFis1
12668660 This protein mediates scission of the outer mitochondrial membrane, resulting in fragmentation and fission of the mitochondrial network. Inhibition of Drp1 prevented p20-induced fission of mitochondria.
12618434 DNM1L performs an essential but transient role in peroxisome division
12499366 role in peroxisomal fission
11514614 contributes to mitochondrial division in mammalian cells

AA Sequence

MEALIPVINKLQDVFNTVGADIIQLPQIVVVGTQSSGKSSVLESLVGRDLLPRGTGIVTRRPLILQLVHV      1 - 70
SQEDKRKTTGEENGVEAEEWGKFLHTKNKLYTDFDEIRQEIENETERISGNNKGVSPEPIHLKIFSPNVV     71 - 140
NLTLVDLPGMTKVPVGDQPKDIELQIRELILRFISNPNSIILAVTAANTDMATSEALKISREVDPDGRRT    141 - 210
LAVITKLDLMDAGTDAMDVLMGRVIPVKLGIIGVVNRSQLDINNKKSVTDSIRDEYAFLQKKYPSLANRN    211 - 280
GTKYLARTLNRLLMHHIRDCLPELKTRINVLAAQYQSLLNSYGEPVDDKSATLLQLITKFATEYCNTIEG    281 - 350
TAKYIETSELCGGARICYIFHETFGRTLESVDPLGGLNTIDILTAIRNATGPRPALFVPEVSFELLVKRQ    351 - 420
IKRLEEPSLRCVELVHEEMQRIIQHCSNYSTQELLRFPKLHDAIVEVVTCLLRKRLPVTNEMVHNLVAIE    421 - 490
LAYINTKHPDFADACGLMNNNIEEQRRNRLARELPSAVSRDKSSKVPSALAPASQEPSPAASAEADGKLI    491 - 560
QDSRRETKNVASGGGGVGDGVQEPTTGNWRGMLKTSKAEELLAEEKSKPIPIMPASPQKGHAVNLLDVPV    561 - 630
PVARKLSAREQRDCEVIERLIKSYFLIVRKNIQDSVPKAVMHFLVNHVKDTLQSELVGQLYKSSLLDDLL    631 - 700
TESEDMAQRRKEAADMLKALQGASQIIAEIRETHLW                                      701 - 736
//

Text Mined References (176)

PMID Year Title
27145208 2016 A novel de novo dominant negative mutation in DNM1L impairs mitochondrial fission and presents as childhood epileptic encephalopathy.
27059175 2016 SAMM50 Affects Mitochondrial Morphology through the Association of Drp1 in Mammalian Cells.
26992161 2016 Postnatal microcephaly and pain insensitivity due to a de novo heterozygous DNM1L mutation causing impaired mitochondrial fission and function.
26915633 2016 Drp1-Dependent Mitochondrial Autophagy Plays a Protective Role Against Pressure Overload-Induced Mitochondrial Dysfunction and Heart Failure.
26903540 2016 Drp1-dependent mitochondrial fission via MiD49/51 is essential for apoptotic cristae remodeling.
26825290 2016 Lethal Disorder of Mitochondrial Fission Caused by Mutations in DNM1L.
26812016 2016 The 1p36 Tumor Suppressor KIF 1B? Is Required for Calcineurin Activation, Controlling Mitochondrial Fission and Apoptosis.
26618722 2016 Parkinson's disease-associated mutant VPS35 causes mitochondrial dysfunction by recycling DLP1 complexes.
26609810 2015 Actin filaments target the oligomeric maturation of the dynamin GTPase Drp1 to mitochondrial fission sites.
26604000 2016 DNM1L-related mitochondrial fission defect presenting as refractory epilepsy.
26598294 2015 Dynamin-related protein 1 mediates mitochondria-dependent apoptosis in chlorpyrifos-treated SH-SY5Y cells.
26578513 2016 Distinct Splice Variants of Dynamin-related Protein 1 Differentially Utilize Mitochondrial Fission Factor as an Effector of Cooperative GTPase Activity.
26577411 2015 Blockade of Drp1 rescues oxidative stress-induced osteoblast dysfunction.
26518267 2015 Heterogeneous nuclear ribonucleoprotein A1 post-transcriptionally regulates Drp1 expression in neuroblastoma cells.
26384664 2015 MAPL SUMOylation of Drp1 Stabilizes an ER/Mitochondrial Platform Required for Cell Death.
26381214 2015 Regulation of NKT cell-mediated immune responses to tumours and liver inflammation by mitochondrial PGAM5-Drp1 signalling.
26358295 2015 COX assembly factor ccdc56 regulates mitochondrial morphology by affecting mitochondrial recruitment of Drp1.
26356820 2015 Bax-PGAM5L-Drp1 complex is required for intrinsic apoptosis execution.
26122121 2015 Signal transducer and activator of transcription 2 deficiency is a novel disorder of mitochondrial fission.
26114658 2015 A novel autophagy/mitophagy inhibitor liensinine sensitizes breast cancer cells to chemotherapy through DNM1L-mediated mitochondrial fission.
26093086 2015 Dynamin-related protein Drp1 is required for Bax translocation to mitochondria in response to irradiation-induced apoptosis.
25822260 2015 Mitochondrial dynamics protein Drp1 is overexpressed in oncocytic thyroid tumors and regulates cancer cell migration.
25770210 2015 The mechanoenzymatic core of dynamin-related protein 1 comprises the minimal machinery required for membrane constriction.
25767741 Interaction with the effector dynamin-related protein 1 (Drp1) is an ancient function of Rab32 subfamily proteins.
25659608 2015 Dynamin-related protein 1 as a therapeutic target in cardiac arrest.
25658205 2015 Erk2 phosphorylation of Drp1 promotes mitochondrial fission and MAPK-driven tumor growth.
25658204 2015 Mitochondrial division is requisite to RAS-induced transformation and targeted by oncogenic MAPK pathway inhibitors.
25487648 2014 BIN1/M-Amphiphysin2 induces clustering of phosphoinositides to recruit its downstream partner dynamin.
25482923 2015 Astrocytic dynamin-like protein 1 regulates neuronal protection against excitotoxicity in Parkinson disease.
25446129 2015 Mitochondrial division inhibitor 1 (mdivi-1) enhances death receptor-mediated apoptosis in human ovarian cancer cells.
25332205 2015 Endogenous Drp1 mediates mitochondrial autophagy and protects the heart against energy stress.
25326752 2014 RNA viruses promote activation of the NLRP3 inflammasome through a RIP1-RIP3-DRP1 signaling pathway.
25284615 2014 MiRNA-30a inhibits AECs-II apoptosis by blocking mitochondrial fission dependent on Drp-1.
25174275 2014 Mitochondrial division inhibitor-1 induces mitochondrial hyperfusion and sensitizes human cancer cells to TRAIL-induced apoptosis.
25082190 2014 Dynamin-1-like protein (Dnm1L) interaction with kinesin light chain 1 (KLC1) through the tetratricopeptide repeat (TPR) domains.
24947026 2014 Exercise training decreases activation of the mitochondrial fission protein dynamin-related protein-1 in insulin-resistant human skeletal muscle.
24899388 2014 Involvement of Drp1 in hypoxia-induced migration of human glioblastoma U251 cells.
24790094 2014 A dimeric equilibrium intermediate nucleates Drp1 reassembly on mitochondrial membranes for fission.
24755420 2014 Dynamin-related protein Drp1 and mitochondria are important for Shigella flexneri infection.
24681098 2014 Dynamin related protein 1-dependent mitochondrial fission regulates oxidative signalling in T cells.
24634514 2014 Impaired OMA1-dependent cleavage of OPA1 and reduced DRP1 fission activity combine to prevent mitophagy in cells that are dependent on oxidative phosphorylation.
24599962 2014 Phosphatidic acid (PA)-preferring phospholipase A1 regulates mitochondrial dynamics.
24302731 2014 A functional interplay between the small GTPase Rab11a and mitochondria-shaping proteins regulates mitochondrial positioning and polarization of the actin cytoskeleton downstream of Src family kinases.
24282027 2014 Functional interaction of Parkinson's disease-associated LRRK2 with members of the dynamin GTPase superfamily.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24252614 2014 Inhibition of ERK-DLP1 signaling and mitochondrial division alleviates mitochondrial dysfunction in Alzheimer's disease cybrid cell.
24206264 2014 Drp1 is dispensable for apoptotic cytochrome c release in primed MCF10A and fibroblast cells but affects Bcl-2 antagonist-induced respiratory changes.
24121705 2013 Dynamin 1-like-dependent mitochondrial fission initiates overactive mitophagy in the hepatotoxicity of cadmium.
24080278 2013 Cytoplasmic irradiation results in mitochondrial dysfunction and DRP1-dependent mitochondrial fission.
23977156 2013 Functional mapping of human dynamin-1-like GTPase domain based on x-ray structure analyses.
23921378 2013 Adaptor proteins MiD49 and MiD51 can act independently of Mff and Fis1 in Drp1 recruitment and are specific for mitochondrial fission.
23813973 2013 Inhibition of excessive mitochondrial fission reduced aberrant autophagy and neuronal damage caused by LRRK2 G2019S mutation.
23792689 2013 A Bcl-xL-Drp1 complex regulates synaptic vesicle membrane dynamics during endocytosis.
23713734 2013 Mitochondrial fusion and fission proteins expression dynamically change in a murine model of amyotrophic lateral sclerosis.
23658835 2013 Downregulation of OPA3 is responsible for transforming growth factor-?-induced mitochondrial elongation and F-actin rearrangement in retinal pigment epithelial ARPE-19 cells.
23641925 2013 S-nitrosylation of dynamin-related protein 1 mediates mutant huntingtin-induced mitochondrial fragmentation and neuronal injury in Huntington's disease.
23584531 2013 Structural insights into oligomerization and mitochondrial remodelling of dynamin 1-like protein.
23582339 2013 Why size matters - balancing mitochondrial dynamics in Alzheimer's disease.
23530241 2013 Interchangeable adaptors regulate mitochondrial dynamin assembly for membrane scission.
23524851 2013 SENP3-mediated deSUMOylation of dynamin-related protein 1 promotes cell death following ischaemia.
23516518 2013 PsVPS1, a dynamin-related protein, is involved in cyst germination and soybean infection of Phytophthora sojae.
23492771 2013 Cadmium induced Drp1-dependent mitochondrial fragmentation by disturbing calcium homeostasis in its hepatotoxicity.
23434681 2013 New insights into the function and regulation of mitochondrial fission.
23349293 2013 An actin-dependent step in mitochondrial fission mediated by the ER-associated formin INF2.
23334860 2013 Role of dynamin-related protein 1 (Drp1)-mediated mitochondrial fission in oxygen sensing and constriction of the ductus arteriosus.
23288151 2013 Dynamin-related protein-1 controls fusion pore dynamics during platelet granule exocytosis.
23284813 2012 TRAP1 controls mitochondrial fusion/fission balance through Drp1 and Mff expression.
23283981 2013 Fis1, Mff, MiD49, and MiD51 mediate Drp1 recruitment in mitochondrial fission.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23185298 2012 GSK3beta-mediated Drp1 phosphorylation induced elongated mitochondrial morphology against oxidative stress.
23028930 2012 Defects in mitochondrial fission protein dynamin-related protein 1 are linked to apoptotic resistance and autophagy in a lung cancer model.
23027751 2012 Purification, crystallization and X-ray diffraction analysis of human dynamin-related protein 1 GTPase-GED fusion protein.
22955947 2013 Suppressor of cytokine signaling 6 (SOCS6) promotes mitochondrial fission via regulating DRP1 translocation.
22745122 2012 Modulation of dynamin-related protein 1 (DRP1) function by increased O-linked-?-N-acetylglucosamine modification (O-GlcNAc) in cardiac myocytes.
22639965 2012 Leucine-rich repeat kinase 2 disturbs mitochondrial dynamics via Dynamin-like protein.
22595283 2012 Mitochondrial chaperone DnaJA3 induces Drp1-dependent mitochondrial fragmentation.
22583914 2013 N-terminal phosphorylation of protein phosphatase 2A/B?2 regulates translocation to mitochondria, dynamin-related protein 1 dephosphorylation, and neuronal survival.
22511751 2012 Dynamin-related protein 1-mediated mitochondrial mitotic fission permits hyperproliferation of vascular smooth muscle cells and offers a novel therapeutic target in pulmonary hypertension.
22487795 2012 Depletion of mitochondrial fission factor DRP1 causes increased apoptosis in human colon cancer cells.
22445325 2012 Extracellular signal-regulated kinase is involved in alpha-synuclein-induced mitochondrial dynamic disorders by regulating dynamin-like protein 1.
22428580 2012 Parkinson's disease-associated DJ-1 mutations impair mitochondrial dynamics and cause mitochondrial dysfunction.
22367970 2012 Abnormal interaction between the mitochondrial fission protein Drp1 and hyperphosphorylated tau in Alzheimer's disease neurons: implications for mitochondrial dysfunction and neuronal damage.
22340708 2012 Mitochondrial fission proteins in peripheral blood lymphocytes are potential biomarkers for Alzheimer's disease.
22265414 2012 The mitochondrial phosphatase PGAM5 functions at the convergence point of multiple necrotic death pathways.
22228096 2012 LRRK2 regulates mitochondrial dynamics and function through direct interaction with DLP1.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
22020994 2012 Endoplasmic reticulum-specific BH3-only protein BNIP1 induces mitochondrial fragmentation in a Bcl-2- and Drp1-dependent manner.
22005465 2011 Ionizing radiation accelerates Drp1-dependent mitochondrial fission, which involves delayed mitochondrial reactive oxygen species production in normal human fibroblast-like cells.
21997870 2012 Mutant huntingtin's interaction with mitochondrial protein Drp1 impairs mitochondrial biogenesis and causes defective axonal transport and synaptic degeneration in Huntington's disease.
21903925 2011 Helicobacter pylori vacuolating cytotoxin A (VacA) engages the mitochondrial fission machinery to induce host cell death.
21840923 2011 Biochemical characterization of human dynamin-like protein 1.
21701560 2011 Human MIEF1 recruits Drp1 to mitochondrial outer membranes and promotes mitochondrial fusion rather than fission.
21615675 2011 DLP1-dependent mitochondrial fragmentation mediates 1-methyl-4-phenylpyridinium toxicity in neurons: implications for Parkinson's disease.
21525035 2011 PEX14 is required for microtubule-based peroxisome motility in human cells.
21508961 2011 MiD49 and MiD51, new components of the mitochondrial fission machinery.
21459773 2011 Impaired mitochondrial dynamics and abnormal interaction of amyloid beta with mitochondrial protein Drp1 in neurons from patients with Alzheimer's disease: implications for neuronal damage.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21336284 2011 Mutant huntingtin binds the mitochondrial fission GTPase dynamin-related protein-1 and increases its enzymatic activity.
21325626 2011 Regulation of mitochondrial morphology by APC/CCdh1-mediated control of Drp1 stability.
21292769 2011 Parkin ubiquitinates Drp1 for proteasome-dependent degradation: implication of dysregulated mitochondrial dynamics in Parkinson disease.
21269460 2011 Initial characterization of the human central proteome.
21217774 2011 RAC3 is a pro-migratory co-activator of ER?.
21172823 2011 An endophilin-dynamin complex promotes budding of clathrin-coated vesicles during synaptic vesicle recycling.
21149567 2010 Mff is an essential factor for mitochondrial recruitment of Drp1 during mitochondrial fission in mammalian cells.
21145355 2011 Dynamin-related protein 1 and mitochondrial fragmentation in neurodegenerative diseases.
20850011 2010 Membrane remodeling induced by the dynamin-related protein Drp1 stimulates Bax oligomerization.
20696759 2010 A lethal de novo mutation in the middle domain of the dynamin-related GTPase Drp1 impairs higher order assembly and mitochondrial division.
20688057 2010 Dynamin-like protein 1 at the Golgi complex: a novel component of the sorting/targeting machinery en route to the plasma membrane.
20683914 2011 Bax is essential for Drp1-mediated mitochondrial fission but not for mitochondrial outer membrane permeabilization caused by photodynamic therapy.
20649536 2010 Dynamic regulation of mitochondrial fission through modification of the dynamin-related protein Drp1.
20467441 2010 Nitric oxide inhibition of Drp1-mediated mitochondrial fission is critical for myogenic differentiation.
20436456 2010 The BH3-only Bnip3 binds to the dynamin Opa1 to promote mitochondrial fragmentation and apoptosis by distinct mechanisms.
20428767 2010 Specific mitochondrial calcium overload induces mitochondrial fission in prostate cancer cells.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20179104 2010 Decreased expression of Drp1 and Fis1 mediates mitochondrial elongation in senescent cells and enhances resistance to oxidative stress through PINK1.
20103533 2010 Loss of MARCH5 mitochondrial E3 ubiquitin ligase induces cellular senescence through dynamin-related protein 1 and mitofusin 1.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19946888 2010 Defining the membrane proteome of NK cells.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19638400 2009 SUMOylation of the mitochondrial fission protein Drp1 occurs at multiple nonconsensus sites within the B domain and is linked to its activity cycle.
19525928 2009 Nuclear expression of dynamin-related protein 1 in lung adenocarcinomas.
19492085 2009 Mitochondrial alterations in PINK1 deficient cells are influenced by calcineurin-dependent dephosphorylation of dynamin-related protein 1.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19411255 2009 Translocation of SenP5 from the nucleoli to the mitochondria modulates DRP1-dependent fission during mitosis.
19409380 2009 Loss of Drp1 function alters OPA1 processing and changes mitochondrial membrane organization.
19407830 2009 MAPL is a new mitochondrial SUMO E3 ligase that regulates mitochondrial fission.
19342591 2009 S-nitrosylation of Drp1 mediates beta-amyloid-related mitochondrial fission and neuronal injury.
19279012 2009 Loss of PINK1 function promotes mitophagy through effects on oxidative stress and mitochondrial fission.
19074440 2009 Endophilin B1/Bif-1 stimulates BAX activation independently from its capacity to produce large scale membrane morphological rearrangements.
18838687 2008 Dephosphorylation by calcineurin regulates translocation of Drp1 to mitochondria.
18695047 2008 CaM kinase I alpha-induced phosphorylation of Drp1 regulates mitochondrial morphology.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18599615 2008 Dynamin-like protein 1 reduction underlies mitochondrial morphology and distribution abnormalities in fibroblasts from sporadic Alzheimer's disease patients.
18465792 2008 Shaping mitochondria: The complex posttranslational regulation of the mitochondrial fission protein DRP1.
18353969 2008 The novel tail-anchored membrane protein Mff controls mitochondrial and peroxisomal fission in mammalian cells.
18088087 2008 Phosphoproteome of resting human platelets.
17906671 2007 The phosphorylation state of Drp1 determines cell fate.
17721437 2007 Reversible phosphorylation of Drp1 by cyclic AMP-dependent protein kinase and calcineurin regulates mitochondrial fission and cell death.
17718388 2007 [Role of transmembrane GTPases in mitochondrial morphology and activity].
17682056 2007 Drp1 mediates caspase-independent type III cell death in normal and leukemic cells.
17606867 2007 The mitochondrial E3 ubiquitin ligase MARCH5 is required for Drp1 dependent mitochondrial division.
17553808 2007 Cyclic AMP-dependent protein kinase phosphorylation of Drp1 regulates its GTPase activity and mitochondrial morphology.
17460227 2007 A lethal defect of mitochondrial and peroxisomal fission.
17408615 2007 Fis1, DLP1, and Pex11p coordinately regulate peroxisome morphogenesis.
17332775 2007 Inhibiting Drp1-mediated mitochondrial fission selectively prevents the release of cytochrome c during apoptosis.
17301055 2007 Mitotic phosphorylation of dynamin-related GTPase Drp1 participates in mitochondrial fission.
17015472 2006 Inhibiting the mitochondrial fission machinery does not prevent Bax/Bak-dependent apoptosis.
16936636 2006 MARCH-V is a novel mitofusin 2- and Drp1-binding protein able to change mitochondrial morphology.
16874301 2006 A novel mitochondrial ubiquitin ligase plays a critical role in mitochondrial dynamics.
16541075 2006 The finished DNA sequence of human chromosome 12.
16010987 2005 Regulation of Ca2+-induced permeability transition by Bcl-2 is antagonized by Drpl and hFis1.
15824135 2005 An internal GAP domain negatively regulates presynaptic dynamin in vivo: a two-step model for dynamin function.
15791210 2005 Endoplasmic reticulum BIK initiates DRP1-regulated remodelling of mitochondrial cristae during apoptosis.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15383276 2004 A protein interaction network links GIT1, an enhancer of huntingtin aggregation, to Huntington's disease.
15364948 2004 Mitochondria-specific function of the dynamin family protein DLP1 is mediated by its C-terminal domains.
15356267 2004 Roles of the mammalian mitochondrial fission and fusion mediators Fis1, Drp1, and Opa1 in apoptosis.
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15208300 2004 Intra- and intermolecular domain interactions of the C-terminal GTPase effector domain of the multimeric dynamin-like GTPase Drp1.
14741701 2004 Genomic organization, alternative splicing, and promoter analysis of human dynamin-like protein gene.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12861026 2003 The mitochondrial protein hFis1 regulates mitochondrial fission in mammalian cells through an interaction with the dynamin-like protein DLP1.
12668660 2003 Caspase cleavage product of BAP31 induces mitochondrial fission through endoplasmic reticulum calcium signals, enhancing cytochrome c release to the cytosol.
12618434 2003 The dynamin-like GTPase DLP1 is essential for peroxisome division and is recruited to peroxisomes in part by PEX11.
12499366 2003 Dynamin-like protein 1 is involved in peroxisomal fission.
12499352 2002 Spatial and temporal association of Bax with mitochondrial fission sites, Drp1, and Mfn2 during apoptosis.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11514614 2001 Dynamin-related protein Drp1 is required for mitochondrial division in mammalian cells.
10749171 2000 Differential expression of four human dynamin-like protein variants in brain tumors.
9915810 1999 Intermolecular and interdomain interactions of a dynamin-related GTP-binding protein, Dnm1p/Vps1p-like protein.
9786947 1998 A human dynamin-related protein controls the distribution of mitochondria.
9731200 1998 Human dynamin-like protein interacts with the glycogen synthase kinase 3beta.
9570752 1998 Identification and functional characterization of a novel human protein highly related to the yeast dynamin-like GTPase Vps1p.
9472031 1998 A novel dynamin-like protein associates with cytoplasmic vesicles and tubules of the endoplasmic reticulum in mammalian cells.
9422767 1998 Dymple, a novel dynamin-like high molecular weight GTPase lacking a proline-rich carboxyl-terminal domain in mammalian cells.
9348079 1997 Identification and subcellular localization of a novel mammalian dynamin-related protein homologous to yeast Vps1p and Dnm1p.