Property Summary

NCBI Gene PubMed Count 126
PubMed Score 421.08
PubTator Score 111.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
interstitial lung disease 1.200 2.4e-02
malignant mesothelioma 1.200 6.8e-06
astrocytoma -2.500 2.0e-19
ependymoma -4.400 2.1e-24
psoriasis -2.200 2.1e-09
glioblastoma -3.100 2.4e-07
oligodendroglioma -2.700 2.9e-17
sonic hedgehog group medulloblastoma -4.100 1.9e-10
atypical teratoid / rhabdoid tumor -3.700 1.1e-08
medulloblastoma, large-cell -2.800 1.0e-07
primitive neuroectodermal tumor -2.100 1.0e-03
pediatric high grade glioma -3.200 3.6e-10
pilocytic astrocytoma -2.500 8.6e-12
lung carcinoma 1.600 5.0e-24
Pick disease -2.100 1.2e-02
ductal carcinoma in situ -1.100 2.3e-02
invasive ductal carcinoma -1.400 1.3e-02
facioscapulohumeral dystrophy 1.800 4.6e-02

Protein-protein Interaction (8)

Gene RIF (52)

PMID Text
27094744 Hypoxic down-regulation of constitutive endocytosis is HIF-independent, and involves caveolin-1-mediated inhibition of dynamin-dependent, membrane raft endocytosis.
26659814 Data indicate that stimulation of the dynamin GTPase activity by SH3 domains is determined by its middle domain.
26611353 study reports 2 patients with early onset epileptic encephalopathy possessing de novo DNM1 mutations; detected the novel mutation c.127G>A (p.Gly43Ser) in a patient with Lennox-Gastaut syndrome, and a recurrent mutation c.709C>T (p.Arg237Trp) in a patient with West syndrome
26479317 Data indicate the dynamics of a dynamin 1-catalysed GTP hydrolysis and tube-severing reaction in real time using fluorescence microscopy.
26165689 findings support a role for HTT on dynamin 1 function and ER homoeostasis. Proteolysis-induced alteration of this function may be relevant to disease.
26139537 CRISPR-Cas9n-mediated knockout and reconstitution studies establish that dynamin-1 is activated by Akt/GSK3beta signaling in H1299 non-small lung cancer cells.
26123023 molecular simulations corroborate the bimodal character of dynamin action and indicate radial and axial forces as dominant, although not independent, drivers of hemi-fission and fission membrane- transformations, respectively
25690657 Data suggest that by binding to both clathrin and F-actin, mammalian actin-binding protein 1 (mAbp1; HIP-55 or SH3P7) is specifically recruited at a late stage of clathrin-coated pits (CCPs) formation, which subsequently recruits dynamin to CCPs.
25450229 The rare variants in DNM1 were significantly associated with smoking status.
25262651 De novo mutations in synaptic transmission genes including DNM1 cause epileptic encephalopathies.
25116793 Dynamin 1 and dynamin 2 activity are not essential for Chlamydia trachomatis internalization but is required for normal development.
25048004 This study identified and confirmed DNM1 protein changes within the postsynaptic density in schizophrenia.
25031323 determined the alpha-synuclein-binding domain of beta-III tubulin and demonstrated that a short fragment containing this domain can suppress alpha-synuclein accumulation in the primary cultured cells
24970086 findings show NDPKs (NM23-H1/H2/H4) interact with and provide GTP to dynamins, allowing these motor proteins to work with high thermodynamic efficiency for membrane remodeling
24673776 Data show that the classical dynamin DNM1 and DNM3 genes reach their maximum expression levels (100% of maximal expression) in all normal central nervous system tissues studied.
24616919 Data suggest that dynorphin A (DynA) is ligand for opioid receptor kappa (KOR); upon DynA binding, only small chemical shifts observed in second extracellular loop of KOR; chemical shift changes of DynA show conclusively that DynA interacts with KOR.
24486840 Dynamin1 is associated with both preserved cognition and regenerative responses in older people with cerebrovascular disease and may represent a novel treatment target.
24478459 Alternate pleckstrin homology domain orientations regulate dynamin-catalyzed membrane fission.
23908769 activity-dependent acceleration is only prominent at physiological temperature and that the mechanism of this modulation is based on the dephosphorylation of dynamin 1
23793749 The discovery that the pre-mRNA sequence of dnm1 in humans has sequence features similar to that of the alternative splicing patterns observed in insects greatly expands the applicability of the docking site-selector sequence pairing model to bilaterian animals.
23705820 analysis of how the membrane interactions of disease-related dynorphin A variants cause differences in cell toxicity
23170932 Dynamin-dependent endocytosis is required for intracellular accumulation of HIV-1 Gag in the presence of HLA-DR
23024787 dyn1 affects amyloid generation through regulation of BACE-1 subcellular localization and therefore its enzymatic activities.
22846998 Dynamin-dependent endocytosis is required for intracellular accumulation of HIV-1 Gag in the presence of HLA-DR
22022400 Herpes simplex virus type 1 can enter human keratinocytes by alternative entry pathways that require dynamin and host cholesterol.
21962517 Study presents the GMPPCP-bound structures of the truncated human dynamin 1 helical polymer at 12.2 A and a fusion protein, GG, linking human dynamin 1's catalytic G domain to its GTPase effector domain (GED) at 2.2 A.
21927000 crystal structure of human dynamin 1 in the nucleotide-free state with a four-domain architecture comprising the GTPase domain, the bundle signalling element, the stalk and the pleckstrin homology domain.
21460182 A new role for the dynamin-1 GTPase in the regulation of fusion pore expansion
21056892 The authors find that HIV-1 entry into macrophages is sensitive to inhibitors of Na(+)/H(+) exchange, actin rearrangement, dynamin, Rac1, and Pak1.
20690924 In conclusion, Clostridium botulinum C2 toxin is endocytosed by dynamin-dependent mechanisms and we provide evidence for involvement of clathrin and Rho.
20428113 2.0 A resolution crystal structure of a human dynamin 1-derived minimal GTPase-GED fusion protein, which was dimeric in the presence of the transition state mimic GDP.AlF(4)(-)
19859085 Endocytosis of FcalphaR is clathrin- and dynamin-dependent, but is not regulated by Rab5, and the endocytic motif is not located in the cytoplasmic domain of FcalphaR.
19776347 Results demonstrate that, in concert with dynamin-1 self-assembly, pleckstrin homology domain membrane insertion is essential for fission and vesicle release in vitro and for clathrin-mediated endocytosis in vivo.
19666604 The ability of dynamin to alter the local distribution of PtdIns(4,5)P(2) could be crucial for the role of this GTPase in promoting membrane scission during clathrin-mediated endocytosis.
19515832 Data suggest that the components of the GTPase-GED interface act as an intramolecular signaling module, which we term the bundle signaling element, that can modulate dynamin function in vitro and in vivo.
19110265 This protein has been found differentially expressed in the dorsolateral prefrontal cortex from patients with schizophrenia.
18987626 our findings indicate that DNM1 is likely involved in the etiology of nicotine dependence and represents a plausible candidate for further investigation in independent samples
18987626 Observational study of gene-disease association. (HuGE Navigator)
18836734 Data show that dynamin-1 is an inclusion body component in neuronal intranuclear inclusion disease identified by anti-SUMO-1-immunocapture.
18602423 Dynamin-dependent endocytosis is required for intracellular accumulation of HIV-1 Gag in the presence of HLA-DR
17910478 Pockets of short-range transient order and restricted topological heterogeneity in the guanidine-denatured state ensemble of GED of DNM1.
17170701 Two mutations in middle domain, R361S and R399A, disrupt the tetrameric structure of dynamin in the unassembled state and impair its ability to stably bind to and nucleate higher-order self-assembly on membranes.
16938290 Data show that swapping the highly homologous GTPase domain of dynamin-2 into dynamin-1 is sufficient to confer caspase-3 activation.
16622417 PLD functions as a GTPase activating protein (GAP) through its phox homology domain (PX), which directly activates the GTPase domain of dynamin and increased epidermal growth factor receptor (EGFR) endocytosis at physiological EGF concentrations.
16432212 S-nitrosylation of dynamin regulates endocytosis through nitric oxide
15872089 dynamin, Cbl, and Src coordinately participate in signaling complexes that are important in the assembly and remodeling of the actin cytoskeleton, leading to changes in osteoclast adhesion, migration, and resorption
15262989 Dynamin GTPase domain is important for GTP binding, GTP hydrolysis, and clathrin-mediated endocytosis
15123615 dynamin-1 interacts with Sumo-1, Ubc9, and PIAS-1, all of which are members of the sumoylation machinery
15004222 Point mutations were made in the GTPase effector/assembly domain (GED)of dynamin 1 and tested for their effects on self-assembly and clathrin-mediated endocytosis.
14739229 serglycin-bound granzyme B in high-molecular-weight degranulate material from cytotoxic T lymphocytes predominantly followed a dynamin-dependent pathway to kill target cells
12896979 dynamin-dependent endocytosis is inhibited by syntaphilin
11782545 These findings suggest that dynamin is part of a protein network that controls nucleation of actin from membranes.

AA Sequence

MGNRGMEDLIPLVNRLQDAFSAIGQNADLDLPQIAVVGGQSAGKSSVLENFVGRDFLPRGSGIVTRRPLV      1 - 70
LQLVNATTEYAEFLHCKGKKFTDFEEVRLEIEAETDRVTGTNKGISPVPINLRVYSPHVLNLTLVDLPGM     71 - 140
TKVPVGDQPPDIEFQIRDMLMQFVTKENCLILAVSPANSDLANSDALKVAKEVDPQGQRTIGVITKLDLM    141 - 210
DEGTDARDVLENKLLPLRRGYIGVVNRSQKDIDGKKDITAALAAERKFFLSHPSYRHLADRMGTPYLQKV    211 - 280
LNQQLTNHIRDTLPGLRNKLQSQLLSIEKEVEEYKNFRPDDPARKTKALLQMVQQFAVDFEKRIEGSGDQ    281 - 350
IDTYELSGGARINRIFHERFPFELVKMEFDEKELRREISYAIKNIHGIRTGLFTPDMAFETIVKKQVKKI    351 - 420
REPCLKCVDMVISELISTVRQCTKKLQQYPRLREEMERIVTTHIREREGRTKEQVMLLIDIELAYMNTNH    421 - 490
EDFIGFANAQQRSNQMNKKKTSGNQDEILVIRKGWLTINNIGIMKGGSKEYWFVLTAENLSWYKDDEEKE    491 - 560
KKYMLSVDNLKLRDVEKGFMSSKHIFALFNTEQRNVYKDYRQLELACETQEEVDSWKASFLRAGVYPERV    561 - 630
GDKEKASETEENGSDSFMHSMDPQLERQVETIRNLVDSYMAIVNKTVRDLMPKTIMHLMINNTKEFIFSE    631 - 700
LLANLYSCGDQNTLMEESAEQAQRRDEMLRMYHALKEALSIIGDINTTTVSTPMPPPVDDSWLQVQSVPA    701 - 770
GRRSPTSSPTPQRRAPAVPPARPGSRGPAPGPPPAGSALGGAPPVPSRPGASPDPFGPPPQVPSRPNRAP    771 - 840
PGVPSRSGQASPSRPESPRPPFDL                                                  841 - 864
//

Text Mined References (134)

PMID Year Title
27094744 2016 Hypoxia regulates global membrane protein endocytosis through caveolin-1 in cancer cells.
26659814 2015 SH3 Domains Differentially Stimulate Distinct Dynamin I Assembly Modes and G Domain Activity.
26611353 2016 De novo DNM1 mutations in two cases of epileptic encephalopathy.
26479317 2015 A high-throughput platform for real-time analysis of membrane fission reactions reveals dynamin function.
26165689 2015 Huntingtin proteolysis releases non-polyQ fragments that cause toxicity through dynamin 1 dysregulation.
26139537 2015 Crosstalk between Akt/GSK3? signaling and dynamin-1 regulates clathrin-mediated endocytosis.
26123023 2015 A hemi-fission intermediate links two mechanistically distinct stages of membrane fission.
25690657 2015 Mammalian actin-binding protein 1/HIP-55 is essential for the scission of clathrin-coated pits by regulating dynamin-actin interaction.
25533962 2015 Large-scale discovery of novel genetic causes of developmental disorders.
25450229 2015 The contribution of rare and common variants in 30 genes to risk nicotine dependence.
25262651 2014 De novo mutations in synaptic transmission genes including DNM1 cause epileptic encephalopathies.
25116793 2014 Dynamin-mediated lipid acquisition is essential for Chlamydia trachomatis development.
25048004 2015 Proteomic and genomic evidence implicates the postsynaptic density in schizophrenia.
25031323 2014 Dynamin1 is a novel target for IRSp53 protein and works with mammalian enabled (Mena) protein and Eps8 to regulate filopodial dynamics.
24970086 2014 Membrane trafficking. Nucleoside diphosphate kinases fuel dynamin superfamily proteins with GTP for membrane remodeling.
24673776 2014 Classical dynamin DNM1 and DNM3 genes attain maximum expression in the normal human central nervous system.
24616919 2014 Direct detection of neuropeptide dynorphin A binding to the second extracellular loop of the ? opioid receptor using a soluble protein scaffold.
24486840 2014 Dynamin protein in stroke and vascular dementia.
24478459 2014 Alternate pleckstrin homology domain orientations regulate dynamin-catalyzed membrane fission.
24282027 2014 Functional interaction of Parkinson's disease-associated LRRK2 with members of the dynamin GTPase superfamily.
23908769 2013 Dynamin phosphorylation controls optimization of endocytosis for brief action potential bursts.
23793749 2013 Mechanistic insights into mutually exclusive splicing in dynamin 1.
23705820 2013 Membrane interaction of disease-related dynorphin A variants.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23325789 2013 cAMP-stimulated phosphorylation of diaphanous 1 regulates protein stability and interaction with binding partners in adrenocortical cells.
23024787 2012 Dynamin 1 regulates amyloid generation through modulation of BACE-1.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22022400 2011 Entry pathways of herpes simplex virus type 1 into human keratinocytes are dynamin- and cholesterol-dependent.
21962517 2011 A pseudoatomic model of the dynamin polymer identifies a hydrolysis-dependent powerstroke.
21927000 2011 Crystal structure of nucleotide-free dynamin.
21706016 2011 Selected reaction monitoring mass spectrometry reveals the dynamics of signaling through the GRB2 adaptor.
21460182 2011 A new role for the dynamin GTPase in the regulation of fusion pore expansion.
21269460 2011 Initial characterization of the human central proteome.
21056892 2011 HIV-1 infects macrophages by exploiting an endocytic route dependent on dynamin, Rac1 and Pak1.
20935625 2010 Direct dynamin-actin interactions regulate the actin cytoskeleton.
20700106 2010 Dynamin GTPase regulation is altered by PH domain mutations found in centronuclear myopathy patients.
20690924 2010 Clostridium botulinum C2 toxin is internalized by clathrin- and Rho-dependent mechanisms.
20428113 2010 G domain dimerization controls dynamin's assembly-stimulated GTPase activity.
19859085 2010 Endocytosis of FcalphaR is clathrin and dynamin dependent, but its cytoplasmic domain is not required.
19781630 2010 UNC119 inhibits dynamin and dynamin-dependent endocytic processes.
19776347 2009 Membrane insertion of the pleckstrin homology domain variable loop 1 is critical for dynamin-catalyzed vesicle scission.
19706678 2009 Axonal targeting of Caspr2 in hippocampal neurons via selective somatodendritic endocytosis.
19666604 2009 A possible effector role for the pleckstrin homology (PH) domain of dynamin.
19515832 2009 An intramolecular signaling element that modulates dynamin function in vitro and in vivo.
19110265 2009 Proteomic analysis of dorsolateral prefrontal cortex indicates the involvement of cytoskeleton, oligodendrocyte, energy metabolism and new potential markers in schizophrenia.
18987626 2009 Detection of genetic association and a functional polymorphism of dynamin 1 gene with nicotine dependence in European and African Americans.
18839057 2008 Molecular genetics of adult ADHD: converging evidence from genome-wide association and extended pedigree linkage studies.
18836734 2008 NSF, Unc-18-1, dynamin-1 and HSP90 are inclusion body components in neuronal intranuclear inclusion disease identified by anti-SUMO-1-immunocapture.
18539136 2008 Alternative splicing affecting the SH3A domain controls the binding properties of intersectin 1 in neurons.
18353773 2008 A novel sorting nexin modulates endocytic trafficking and alpha-secretase cleavage of the amyloid precursor protein.
18088087 2008 Phosphoproteome of resting human platelets.
17910478 2007 Pockets of short-range transient order and restricted topological heterogeneity in the guanidine-denatured state ensemble of GED of dynamin.
17500595 2007 Huntingtin interacting proteins are genetic modifiers of neurodegeneration.
17474147 2007 Systematic identification of SH3 domain-mediated human protein-protein interactions by peptide array target screening.
17257598 2007 Myosin 1E interacts with synaptojanin-1 and dynamin and is involved in endocytosis.
17170701 2007 The dynamin middle domain is critical for tetramerization and higher-order self-assembly.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16938290 2006 Domain requirements for an endocytosis-independent, isoform-specific function of dynamin-2.
16648839 2006 GTP-dependent twisting of dynamin implicates constriction and tension in membrane fission.
16622417 2006 The phox homology domain of phospholipase D activates dynamin GTPase activity and accelerates EGFR endocytosis.
16432212 2006 Nitric oxide regulates endocytosis by S-nitrosylation of dynamin.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16275660 2006 Identification of VCP/p97, carboxyl terminus of Hsp70-interacting protein (CHIP), and amphiphysin II interaction partners using membrane-based human proteome arrays.
16234328 2005 NOSTRIN functions as a homotrimeric adaptor protein facilitating internalization of eNOS.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
16137687 2005 SNX9 as an adaptor for linking synaptojanin-1 to the Cdc42 effector ACK1.
15872089 2005 Dynamin forms a Src kinase-sensitive complex with Cbl and regulates podosomes and osteoclast activity.
15834155 2005 Kinetics of Src homology 3 domain association with the proline-rich domain of dynamins: specificity, occlusion, and the effects of phosphorylation.
15703209 2005 SNX9 regulates dynamin assembly and is required for efficient clathrin-mediated endocytosis.
15592455 2005 Immunoaffinity profiling of tyrosine phosphorylation in cancer cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15262989 2004 Dynamin GTPase domain mutants that differentially affect GTP binding, GTP hydrolysis, and clathrin-mediated endocytosis.
15252117 2004 Phospholipase C-gamma1 is a guanine nucleotide exchange factor for dynamin-1 and enhances dynamin-1-dependent epidermal growth factor receptor endocytosis.
15252009 2004 A novel dynamin-associating molecule, formin-binding protein 17, induces tubular membrane invaginations and participates in endocytosis.
15164053 2004 DNA sequence and analysis of human chromosome 9.
15146195 2004 Time-controlled transcardiac perfusion cross-linking for the study of protein interactions in complex tissues.
15123615 2004 Dynamin interacts with members of the sumoylation machinery.
15004222 2004 An assembly-incompetent mutant establishes a requirement for dynamin self-assembly in clathrin-mediated endocytosis in vivo.
14739229 2004 The granzyme B-serglycin complex from cytotoxic granules requires dynamin for endocytosis.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14506234 2003 Tuba, a novel protein containing bin/amphiphysin/Rvs and Dbl homology domains, links dynamin to regulation of the actin cytoskeleton.
12896979 2003 Syntaphilin binds to dynamin-1 and inhibits dynamin-dependent endocytosis.
12855954 2003 Cdk5 is essential for synaptic vesicle endocytosis.
12517701 2003 Dynamin at the actin-membrane interface.
12511974 2002 Dynamin: characteristics, mechanism of action and function.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12419186 2002 Dynamin2 and cortactin regulate actin assembly and filament organization.
12383797 2002 Dynamin and endocytosis.
12359736 2002 The betagamma subunit of heterotrimeric G proteins interacts with RACK1 and two other WD repeat proteins.
12011079 2002 Src-dependent tyrosine phosphorylation regulates dynamin self-assembly and ligand-induced endocytosis of the epidermal growth factor receptor.
11956154 2002 The endocytosis-linked protein dynamin associates with caveolin-1 and is tyrosine phosphorylated in response to the activation of a noninternalizing epidermal growth factor receptor mutant.
11877424 2002 Dynamin is a minibrain kinase/dual specificity Yak1-related kinase 1A substrate.
11872741 2002 Interactions of phocein with nucleoside-diphosphate kinase, Eps15, and Dynamin I.
11782545 2002 Dynamin at actin tails.
11563969 2001 Chloride intracellular channel protein CLIC4 (p64H1) binds directly to brain dynamin I in a complex containing actin, tubulin and 14-3-3 isoforms.
11557983 2001 The SH2/SH3 adaptor Grb4 transduces B-ephrin reverse signals.
11483962 2001 The Eps15 C. elegans homologue EHS-1 is implicated in synaptic vesicle recycling.
11341978 2001 Dynamin inhibits phosphatidylinositol 3-kinase in hematopoietic cells.
11242086 2001 GTPase activity of dynamin and resulting conformation change are essential for endocytosis.
11179417 2001 Division of mitochondria requires a novel DMN1-interacting protein, Net2p.
11082044 2000 All three PACSIN isoforms bind to endocytic proteins and inhibit endocytosis.
11038180 2000 Gag3p, an outer membrane protein required for fission of mitochondrial tubules.
10944110 2000 Dynamin mediates caveolar sequestration of muscarinic cholinergic receptors and alteration in NO signaling.
10931822 2000 The calcineurin-binding protein cain is a negative regulator of synaptic vesicle endocytosis.
10899172 2000 Specificity of the binding of synapsin I to Src homology 3 domains.
10862698 2000 Proteomic analysis of NMDA receptor-adhesion protein signaling complexes.
10766777 2000 Phosphorylation of dynamin I on Ser-795 by protein kinase C blocks its association with phospholipids.
10764144 2000 The interaction between EEN and Abi-1, two MLL fusion partners, and synaptojanin and dynamin: implications for leukaemogenesis.
10542231 1999 The SH3 domains of endophilin and amphiphysin bind to the proline-rich region of synaptojanin 1 at distinct sites that display an unconventional binding specificity.
10521508 1999 Trafficking of the HIV coreceptor CXCR4. Role of arrestins and identification of residues in the c-terminal tail that mediate receptor internalization.
10430869 1999 Crystal structure of the alpha appendage of AP-2 reveals a recruitment platform for clathrin-coat assembly.
10373452 1999 EHSH1/intersectin, a protein that contains EH and SH3 domains and binds to dynamin and SNAP-25. A protein connection between exocytosis and endocytosis?
10336464 1999 Splice variants of intersectin are components of the endocytic machinery in neurons and nonneuronal cells.
10206341 1999 Characterization of interactions of Nck with Sos and dynamin.
9950691 1999 Syndapin I, a synaptic dynamin-binding protein that associates with the neural Wiskott-Aldrich syndrome protein.
9880482 1999 Src-mediated tyrosine phosphorylation of dynamin is required for beta2-adrenergic receptor internalization and mitogen-activated protein kinase signaling.
9694653 1998 Role of phosphorylation in regulation of the assembly of endocytic coat complexes.
9463375 1998 In mouse brain profilin I and profilin II associate with regulators of the endocytic pathway and actin assembly.
9348539 1997 Amphiphysin heterodimers: potential role in clathrin-mediated endocytosis.
9280305 1997 Clathrin interacts specifically with amphiphysin and is displaced by dynamin.
9238017 1997 The SH3p4/Sh3p8/SH3p13 protein family: binding partners for synaptojanin and dynamin via a Grb2-like Src homology 3 domain.
9195986 1997 Identification and characterization of a nerve terminal-enriched amphiphysin isoform.
9148966 1997 The SH3 domain of amphiphysin binds the proline-rich domain of dynamin at a single site that defines a new SH3 binding consensus sequence.
9143509 1997 Assignment of the dynamin-1 gene (DNM1) to human chromosome 9q34 by fluorescence in situ hybridization and somatic cell hybrid analysis.
9110174 1997 Large-scale concatenation cDNA sequencing.
8619474 1996 A "double adaptor" method for improved shotgun library construction.
8308025 1994 Differential expression and regulation of multiple dynamins.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
8119878 1994 Association of Ash/Grb-2 with dynamin through the Src homology 3 domain.
8101525 1993 Mutations in human dynamin block an intermediate stage in coated vesicle formation.
7954789 1994 Crystal structure at 2.2 A resolution of the pleckstrin homology domain from human dynamin.
7850421 1994 Three-dimensional solution structure of the pleckstrin homology domain from dynamin.
7634088 1994 Crystal structure of the pleckstrin homology domain from dynamin.
2144893 1990 Molecular cloning of the microtubule-associated mechanochemical enzyme dynamin reveals homology with a new family of GTP-binding proteins.