Property Summary

NCBI Gene PubMed Count 132
PubMed Score 450.03
PubTator Score 111.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Dog Diseases 2 0.0 0.0
Epileptic encephalopathy, early infantile, 31 2 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Kidney cancer 2613 0.0 0.6
Disease Target Count Z-score Confidence
Attention deficit hyperactivity disorder 278 0.0 1.4
Disease Target Count
Lennox-Gastaut syndrome 34

Expression

  Differential Expression (18)

Disease log2 FC p
adult high grade glioma -3.200 6.5e-08
astrocytic glioma -2.200 1.7e-03
Astrocytoma, Pilocytic -2.400 4.6e-12
atypical teratoid / rhabdoid tumor -3.700 1.1e-08
ductal carcinoma in situ -1.100 2.3e-02
ependymoma -2.800 3.0e-03
facioscapulohumeral dystrophy 1.800 4.6e-02
glioblastoma -3.000 2.8e-12
group 3 medulloblastoma -2.500 9.3e-07
interstitial lung disease 1.200 2.4e-02
invasive ductal carcinoma -1.400 1.3e-02
lung carcinoma 1.600 5.0e-24
malignant mesothelioma 1.200 6.8e-06
medulloblastoma, large-cell -2.800 1.0e-07
oligodendroglioma -2.700 2.9e-17
Pick disease -2.100 1.2e-02
primitive neuroectodermal tumor -2.100 1.0e-03
psoriasis -2.200 2.1e-09

PDB (10)

Gene RIF (57)

AA Sequence

MGNRGMEDLIPLVNRLQDAFSAIGQNADLDLPQIAVVGGQSAGKSSVLENFVGRDFLPRGSGIVTRRPLV      1 - 70
LQLVNATTEYAEFLHCKGKKFTDFEEVRLEIEAETDRVTGTNKGISPVPINLRVYSPHVLNLTLVDLPGM     71 - 140
TKVPVGDQPPDIEFQIRDMLMQFVTKENCLILAVSPANSDLANSDALKVAKEVDPQGQRTIGVITKLDLM    141 - 210
DEGTDARDVLENKLLPLRRGYIGVVNRSQKDIDGKKDITAALAAERKFFLSHPSYRHLADRMGTPYLQKV    211 - 280
LNQQLTNHIRDTLPGLRNKLQSQLLSIEKEVEEYKNFRPDDPARKTKALLQMVQQFAVDFEKRIEGSGDQ    281 - 350
IDTYELSGGARINRIFHERFPFELVKMEFDEKELRREISYAIKNIHGIRTGLFTPDMAFETIVKKQVKKI    351 - 420
REPCLKCVDMVISELISTVRQCTKKLQQYPRLREEMERIVTTHIREREGRTKEQVMLLIDIELAYMNTNH    421 - 490
EDFIGFANAQQRSNQMNKKKTSGNQDEILVIRKGWLTINNIGIMKGGSKEYWFVLTAENLSWYKDDEEKE    491 - 560
KKYMLSVDNLKLRDVEKGFMSSKHIFALFNTEQRNVYKDYRQLELACETQEEVDSWKASFLRAGVYPERV    561 - 630
GDKEKASETEENGSDSFMHSMDPQLERQVETIRNLVDSYMAIVNKTVRDLMPKTIMHLMINNTKEFIFSE    631 - 700
LLANLYSCGDQNTLMEESAEQAQRRDEMLRMYHALKEALSIIGDINTTTVSTPMPPPVDDSWLQVQSVPA    701 - 770
GRRSPTSSPTPQRRAPAVPPARPGSRGPAPGPPPAGSALGGAPPVPSRPGASPDPFGPPPQVPSRPNRAP    771 - 840
PGVPSRSGQASPSRPESPRPPFDL                                                  841 - 864
//

Text Mined References (141)

PMID Year Title