Property Summary

NCBI Gene PubMed Count 5
PubMed Score 8.91
PubTator Score 138.91

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Keratoconjunctivitis sicca 25 3.024 1.5

Expression

Gene RIF (3)

AA Sequence

MLRTALRGAPRLLSRVQPRAPCLRRLWGRGARPEVAGRRRAWAWGWRRSSSEQGPGPAAALGRVEAAHYQ      1 - 70
LVYTCKVCGTRSSKRISKLAYHQGVVIVTCPGCQNHHIIADNLGWFSDLNGKRNIEEILTARGEQVHRVA     71 - 140
GEGALELVLEAAGAPTSTAAPEAGEDEGPPSPGKTEPS                                    141 - 178
//

Text Mined References (8)

PMID Year Title