Property Summary

NCBI Gene PubMed Count 16
PubMed Score 27.83
PubTator Score 13.47

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Testicular cancer 25 3.597 1.8
Teratoma 8 3.589 1.8

Gene RIF (12)

AA Sequence

MQSKRDCELWCERVNPENKAALEAWVRETGIRLVQVNGQRKYGGPPPGWVGSPPPAGSEVFIGRLPQDVY      1 - 70
EHQLIPLFQRVGRLYEFRLMMTFSGLNRGFAYARYSSRRGAQAAIATLHNHPLRPSCPLLVCRSTEKCEL     71 - 140
SVDGLPPNLTRSALLLALQPLGPGLQEARLLPSPGPAPGQIALLKFSSHRAAAMAKKALVEGQSHLCGEQ    141 - 210
VAVEWLKPDLKQRLRQQLVGPFLRSPQPEGSQLALARDKLGFQGARATLQLLCQRMKLGSPVFLTKCLGI    211 - 280
GPAGWHRFWYQVVIPGHPVPFSGLIWVVLTLDGRDGHEVAKDAVSVRLLQALSESGANLLWSAGAEAGTM    281 - 350
VKQ                                                                       351 - 353
//

Text Mined References (16)

PMID Year Title