Property Summary

NCBI Gene PubMed Count 32
PubMed Score 97.74
PubTator Score 50.96

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (8)

Disease log2 FC p
malignant mesothelioma -4.200 2.1e-08
psoriasis -1.400 5.2e-04
osteosarcoma 1.478 7.1e-04
atypical teratoid/rhabdoid tumor 1.400 4.8e-07
pediatric high grade glioma 1.100 3.8e-06
group 3 medulloblastoma 1.100 2.2e-04
pilocytic astrocytoma 1.100 3.4e-06
ovarian cancer -1.300 2.0e-04

Protein-protein Interaction (1)

Gene RIF (9)

PMID Text
24242851 15 nonsynonymous human DNase II SNPs were genotyped in three ethnic groups including 16 different populations using the PCR-restriction fragment length polymorphism technique.
24162774 HIV-1 gp120 upregulates the expression of lysosomal deoxyribonuclease II (DNASE2) in human B cells
23019102 study demonstrated the relationship of genotypes/haplotypes with the in vivo DNase II and promoter activities; significant correlations between genotype in each rheumatoid arthritis (RA)-related SNP and enzymatic activity levels were found; alleles associated with RA exhibited a reduction in serum DNase II activity.
18812394 The association of SNPs in the 5'-regulatory region of the DNA degrading enzyme DNASE2 with Rheumatoid Arthritis implies a role for this enzyme in the pathogenesis of this autoimmune disease.
18812394 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17192590 the enzyme is a monomeric phospholipase D-family member with a pseudodimeric protein fold
15723160 Observational study of gene-disease association. (HuGE Navigator)
12694199 Sp1 and Sp3 are involved in up-regulation of this enzyme's transcriptoin during cell differentiation of hl-60 cells.
12147225 upregulation of expression during myelomonocytic differentiation of HL-60 and THP-1 cells

AA Sequence

MIPLLLAALLCVPAGALTCYGDSGQPVDWFVVYKLPALRGSGEAAQRGLQYKYLDESSGGWRDGRALINS      1 - 70
PEGAVGRSLQPLYRSNTSQLAFLLYNDQPPQPSKAQDSSMRGHTKGVLLLDHDGGFWLVHSVPNFPPPAS     71 - 140
SAAYSWPHSACTYGQTLLCVSFPFAQFSKMGKQLTYTYPWVYNYQLEGIFAQEFPDLENVVKGHHVSQEP    141 - 210
WNSSITLTSQAGAVFQSFAKFSKFGDDLYSGWLAAALGTNLQVQFWHKTVGILPSNCSDIWQVLNVNQIA    211 - 280
FPGPAGPSFNSTEDHSKWCVSPKGPWTCVGDMNRNQGEEQRGGGTLCAQLPALWKAFQPLVKNYQPCNGM    281 - 350
ARKPSRAYKI                                                                351 - 360
//

Text Mined References (36)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25187353 2014 Clozapine-induced agranulocytosis is associated with rare HLA-DQB1 and HLA-B alleles.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24242851 2013 Seven nonsynonymous SNPs in the gene encoding human deoxyribonuclease II may serve as a functional SNP potentially implicated in autoimmune dysfunction.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23019102 2012 Genetic and expression analysis of SNPs in the human deoxyribonuclease II: SNPs in the promoter region reduce its in vivo activity through decreased promoter activity.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
18812394 2009 Homozygosity for DNASE2 single nucleotide polymorphisms in the 5'-regulatory region is associated with rheumatoid arthritis.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17192590 2007 Human lysosomal DNase IIalpha contains two requisite PLD-signature (HxK) motifs: evidence for a pseudodimeric structure of the active enzyme species.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15723160 2005 DNase II polymorphisms associated with risk of renal disorder among systemic lupus erythematosus patients.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12944971 2003 Nuclear cataract caused by a lack of DNA degradation in the mouse eye lens.
12754519 2003 Identification and quantification of N-linked glycoproteins using hydrazide chemistry, stable isotope labeling and mass spectrometry.
12694199 2003 Sp1 and Sp3 are involved in up-regulation of human deoxyribonuclease II transcription during differentiation of HL-60 cells.
12594037 2003 A family history of deoxyribonuclease II: surprises from Trichinella spiralis and Burkholderia pseudomallei.
12558498 2003 Structural requirements of human DNase II alpha for formation of the active enzyme: the role of the signal peptide, N-glycosylation, and disulphide bridging.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12147225 2002 Up-regulation of human deoxyribonuclease II gene expression during myelomonocytic differentiation of HL-60 and THP-1 cells.
11906178 2002 Revised structure of the active form of human deoxyribonuclease IIalpha.
10903447 2000 Deoxyribonuclease II: structure and chromosomal localization of the murine gene, and comparison with the genomic structure of the human and three C. elegans homologs.
10675544 2000 The molecular basis for genetic polymorphism of human deoxyribonuclease II (DNase II): a single nucleotide substitution in the promoter region of human DNase II changes the promoter activity.
10080942 1999 Structural requirements of a human deoxyribonuclease II for the development of the active enzyme form, revealed by site-directed mutagenesis.
9924608 1998 Structure and organization of the human deoxyribonuclease II (DNase II) gene.
9812984 1998 The cloning and expression of human deoxyribonuclease II. A possible role in apoptosis.
9714827 1998 Molecular cloning and characterization of human and murine DNase II.
9647784 1998 Cloning of cDNAs encoding porcine and human DNase II.
9535749 1998 Chromosomal localization of a human deoxyribonuclease II gene (DNASE2) to 19p13.2-p13.1 using both the polymerase chain reaction and fluorescence in situ hybridization analysis.
9446563 1998 Molecular cloning of the cDNA encoding human deoxyribonuclease II.
6248503 1980 Purification and properties of deoxyribonuclease II from human urine.
1586130 1992 Genetic polymorphism of human deoxyribonuclease II (DNase II): low activity levels in urine and leukocytes are due to an autosomal recessive allele.
1540651 1992 Human urine deoxyribonuclease II (DNase II) isoenzymes: a novel immunoaffinity purification, biochemical multiplicity, genetic heterogeneity and broad distribution among tissues and body fluids.