Property Summary

NCBI Gene PubMed Count 27
PubMed Score 52.24
PubTator Score 33.71

Knowledge Summary

Patent

No data available

Expression

Gene RIF (8)

PMID Text
24329527 genotyping of all 21 nonsynonymous DNase 1L1 SNPs was performed in 16 populations representing 3 ethnic groups; 2 activity-abolishing and 4 activity-reducing SNPs were confirmed to be functional; may be plausible that a minor allele of 6 SNPs producing a loss-of-function or low-activity variant could serve as a risk factor for disease
24304513 DNASEX and TKTL1 detection in patient blood is associated with poor disease-free survival rate in oral squamous cell carcinoma.
24098122 Yeast two-hybrid screening revealed that DNase X, a glycosylphosphatidyl inositol-anchored mammalian cell-surface protein binds EtpE-C.
20967767 Several SNPs in the deoxyribonuclease I-like 1 (DNase 1L1) and DNase 1L2 were investigated.
20967767 Observational study of genotype prevalence. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20503202 Genotyping of all the non-synonymous SNPs of was performed in three ethnic groups including six different populations using the PCR-RFLP method newly developed.
19913121 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MHYPTALLFLILANGAQAFRICAFNAQRLTLAKVAREQVMDTLVRILARCDIMVLQEVVDSSGSAIPLLL      1 - 70
RELNRFDGSGPYSTLSSPQLGRSTYMETYVYFYRSHKTQVLSSYVYNDEDDVFAREPFVAQFSLPSNVLP     71 - 140
SLVLVPLHTTPKAVEKELNALYDVFLEVSQHWQSKDVILLGDFNADCASLTKKRLDKLELRTEPGFHWVI    141 - 210
ADGEDTTVRASTHCTYDRVVLHGERCRSLLHTAAAFDFPTSFQLTEEEALNISDHYPVEVELKLSQAHSV    211 - 280
QPLSLTVLLLLSLLSPQLCPAA                                                    281 - 302
//

Text Mined References (27)

PMID Year Title
24329527 2014 Evaluation of all nonsynonymous single-nucleotide polymorphisms in the gene encoding human deoxyribonuclease I-like 1, possibly implicated in the blocking of endocytosis-mediated foreign gene transfer.
24304513 2013 A biomarker based detection and characterization of carcinomas exploiting two fundamental biophysical mechanisms in mammalian cells.
24098122 2013 Ehrlichia chaffeensis uses its surface protein EtpE to bind GPI-anchored protein DNase X and trigger entry into mammalian cells.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
20967767 2010 Global analysis of single nucleotide polymorphisms in the exons of human deoxyribonuclease I-like 1 and 2 genes.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20503202 2010 Genetic and expression analysis of all non-synonymous single nucleotide polymorphisms in the human deoxyribonuclease I-like 1 and 2 genes.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
17180083 1996 Isolation, differential splicing and protein expression of a DNase on the human X chromosome.
16569403 2006 Frequency of the deletion polymorphism of DNASE1L1 in 137 patients with acid maltase deficiency (Pompe disease).
16381901 2006 The LIFEdb database in 2006.
16107205 2005 Physical and biochemical properties of mammalian DNase X proteins: non-AUG translation initiation of porcine and bovine mRNAs for DNase X.
15772651 2005 The DNA sequence of the human X chromosome.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11263960 2001 Deletion polymorphism of DNASE1L1, an X-linked DNase I-like gene, in acid maltase deficiency disorders.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11076863 2000 DNA cloning using in vitro site-specific recombination.
10409440 1999 Molecular characterization of a novel endonuclease (Xib) and possible involvement in lysosomal glycogen storage disorders.
9205125 1997 Identification, localization, and expression of two novel human genes similar to deoxyribonuclease I.
9099869 1997 Functional characterization of a human DNase-like protein encoded by a gene positioned in Xq28.
8733135 1996 Long-range sequence analysis in Xq28: thirteen known and six candidate genes in 219.4 kb of high GC DNA between the RCP/GCP and G6PD loci.
8654957 1996 Cloning of a gene encoding a DNase I-like endonuclease in the human Xq28 region.
8541839 1995 A muscle-specific DNase I-like gene in human Xq28.
8248200 1993 Transcriptional organization of a 450-kb region of the human X chromosome in Xq28.