Property Summary

NCBI Gene PubMed Count 9
PubMed Score 5.58
PubTator Score 5.00

Knowledge Summary

Patent

No data available

TINX Plot

Expression

Gene RIF (3)

AA Sequence

MGLLDLCEEVFGTADLYRVLGVRREASDGEVRRGYHKVSLQVHPDRVGEGDKEDATRRFQILGKVYSVLS      1 - 70
DREQRAVYDEQGTVDEDSPVLTQDRDWEAYWRLLFKKISLEDIQAFEKTYKGSEEELADIKQAYLDFKGD     71 - 140
MDQIMESVLCVQYTEEPRIRNIIQQAIDAGEVPSYNAFVKESKQKMNARKRRAQEEAKEAEMSRKELGLD    141 - 210
EGVDSLKAAIQSRQKDRQKEMDNFLAQMEAKYCKSSKGGGKKSALKKEKK                        211 - 260
//

Text Mined References (17)

PMID Year Title