Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.80
PubTator Score 0.60

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (11)

Disease log2 FC p
astrocytic glioma -1.700 1.8e-02
ependymoma -1.600 4.4e-02
oligodendroglioma -1.700 2.2e-02
psoriasis 1.200 6.8e-04
osteosarcoma 1.224 1.2e-03
atypical teratoid / rhabdoid tumor -1.400 9.3e-07
glioblastoma -1.200 1.4e-04
medulloblastoma -1.100 9.1e-05
medulloblastoma, large-cell -1.600 1.4e-04
non primary Sjogren syndrome sicca 1.100 4.6e-02
ovarian cancer 2.100 6.1e-06

Synonym

Accession O75937 B4DUU4 D3DPM0 Q6IBA4 Q8N4Z5 Q9P051 Q9P067
Symbols SPF31
HSPC331

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Protein-protein Interaction (165)

U2SURP   POLR2D   DHX15   PRPF4   SART1   HNRNPR   PRPF3   PPIH   PLRG1   NUDT21   DHX16   AQR   CDC40   PQBP1   PRPF40A   SF3B1   WBP4   SNRNP200   BCAS2   SMNDC1   PRPF6   PCF11   CD2BP2   CPSF4   LSM8   SYF2   HNRNPC   SNRPB2   SNRNP70   SNRPA   SNRPC   HNRNPA1   SNRPA1   HSPA8   GTF2F2   SNRPB   HNRNPL   GCFC2   POLR2C   POLR2E   HNRNPA2B1   POLR2A   U2AF2   PTBP1   POLR2B   HNRNPH1   CSTF2   GTF2F1   FUS   POLR2I   RBMX   EIF4A3   BUD31   SKIV2L2   PAPOLA   HNRNPA3   HNRNPM   POLR2H   POLR2J   HNRNPF   RBM5   POLR2K   SNU13   HNRNPH2   POLR2F   MAGOH   HNRNPK   SNRPE   SNRPF   SNRPG   LSM3   LSM6   SNRPD1   SNRPD2   SNRPD3   POLR2G   POLR2L   TRA2B   SNURF   YBX1   TXNL4A   SRSF3   HNRNPU   U2AF1   SRSF2   CSTF1   SRSF11   SRSF1   SRSF4   CPSF1   SF3A3   ELAVL2   CSTF3   HNRNPA0   SRSF9   SRSF5   SRSF6   SF3B2   SNW1   HNRNPD   EFTUD2   RNPS1   PCBP1   PCBP2   SF3B3   SF3B4   SF3A2   SF3A1   SF1   ELAVL1   SRSF7   USP39   PRPF8   FIP1L1   CWC27   DDX46   PHF5A   PABPN1   ALYREF   DDX42   CHERP   SUGP1   CCAR1   SRRM1   CPSF7   PRPF38A   U2AF1L4   SNRNP27   PRPF31   CTNNBL1   DHX38   PRCC   SYMPK   GPKOW   CLP1   MAGOHB   PPWD1   SNRNP40   RBM17   CDC5L   HNRNPUL1   DDX23   SF3B5   UPF3B   CRNKL1   WDR33   CSTF2T   CWC22   XAB2   RBM22   CWC25   CWC15   CPSF2   TFIP11   PUF60   LSM7   CPSF3   ISY1   PRPF19   SRRM2   WBP11   LSM2   LSM5   LSM4   RBM8A  

Gene RIF (2)

PMID Text
22944692 Positional proteomics analysis identifies the cleavage of human DnaJ (Hsp40) homolog, subfamily C, member 8 (DNAJC8) at amino acid residues 62-63 by the HIV-1 protease
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MAASGESGTSGGGGSTEEAFMTFYSEVKQIEKRDSVLTSKNQIERLTRPGSSYFNLNPFEVLQIDPEVTD      1 - 70
EEIKKRFRQLSILVHPDKNQDDADRAQKAFEAVDKAYKLLLDQEQKKRALDVIQAGKEYVEHTVKERKKQ     71 - 140
LKKEGKPTIVEEDDPELFKQAVYKQTMKLFAELEIKRKEREAKEMHERKRQREEEIEAQEKAKREREWQK    141 - 210
NFEESRDGRVDSWRNFQANTKGKKEKKNRTFLRPPKVKMEQRE                               211 - 253
//

Text Mined References (17)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15635413 2005 Nucleolar proteome dynamics.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12226669 2002 Comprehensive proteomic analysis of the human spliceosome.
11790298 2002 Directed proteomic analysis of the human nucleolus.
11147971 2000 Mammalian HSP40/DNAJ homologs: cloning of novel cDNAs and a proposal for their classification and nomenclature.