Property Summary

NCBI Gene PubMed Count 21
PubMed Score 13.93
PubTator Score 15.64

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
Rheumatoid Arthritis 1.700 2.6e-02
Waldenstrons macroglobulinemia 1.014 4.2e-03
psoriasis -1.300 1.3e-04
atypical teratoid / rhabdoid tumor -1.100 3.6e-04
glioblastoma -1.300 1.7e-03
intraductal papillary-mucinous adenoma (... 1.100 2.0e-02
intraductal papillary-mucinous carcinoma... 1.100 3.2e-02
lung cancer 1.100 6.1e-04
adult high grade glioma -1.400 1.1e-03
group 3 medulloblastoma 1.100 2.3e-02
non primary Sjogren syndrome sicca -1.200 5.0e-03
lung adenocarcinoma 1.003 3.1e-05
ovarian cancer -2.100 7.7e-16

Gene RIF (7)

PMID Text
24789201 ubiquitin-proteasomal regulation of CCRP and HSP70 are important contributors to the regulation of cytoplasmic CAR levels, and hence the ability of CAR to respond to PB or PB-like inducers
23261415 these findings strongly suggest that DnaJC7 participates in p53/MDM2 negative feedback regulatory pathway, and thereby enhancing the stability and activity of p53.
22944692 HIV-1 Vif is identified to have a physical interaction with DnaJ (Hsp40) homolog, subfamily C, member 7 (DNAJC7) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
22190034 HIV-1 Vif is identified to have a physical interaction with DnaJ (Hsp40) homolog, subfamily C, member 7 (DNAJC7) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
20661446 TPR2 exhibited strong interaction with glucocorticoid receptor and progesterone receptors.
18620420 Data show that Tpr2 associates with Hsp90 and Hsp70 complexes, promoted the accumulation of Hsp70 in PR heterocomplexes in the presence of Hsp90. Thus, Tpr2 has the potential to regulate PR chaperoning.
12853476 TPR2 combines two TPR domains and a J domain to regulate the Hsp70/Hsp90 chaperone system.

AA Sequence

MAAAAECDVVMAATEPELLDDQEAKREAETFKEQGNAYYAKKDYNEAYNYYTKAIDMCPKNASYYGNRAA      1 - 70
TLMMLGRFREALGDAQQSVRLDDSFVRGHLREGKCHLSLGNAMAACRSFQRALELDHKNAQAQQEFKNAN     71 - 140
AVMEYEKIAETDFEKRDFRKVVFCMDRALEFAPACHRFKILKAECLAMLGRYPEAQSVASDILRMDSTNA    141 - 210
DALYVRGLCLYYEDCIEKAVQFFVQALRMAPDHEKACIACRNAKALKAKKEDGNKAFKEGNYKLAYELYT    211 - 280
EALGIDPNNIKTNAKLYCNRGTVNSKLRKLDDAIEDCTNAVKLDDTYIKAYLRRAQCYMDTEQYEEAVRD    281 - 350
YEKVYQTEKTKEHKQLLKNAQLELKKSKRKDYYKILGVDKNASEDEIKKAYRKRALMHHPDRHSGASAEV    351 - 420
QKEEEKKFKEVGEAFTILSDPKKKTRYDSGQDLDEEGMNMGDFDPNNIFKAFFGGPGGFSFEASGPGNFF    421 - 490
FQFG                                                                      491 - 494
//

Text Mined References (30)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25036637 2014 A quantitative chaperone interaction network reveals the architecture of cellular protein homeostasis pathways.
24789201 2014 Coordinated regulation of nuclear receptor CAR by CCRP/DNAJC7, HSP70 and the ubiquitin-proteasome system.
23261415 2013 Co-chaperon DnaJC7/TPR2 enhances p53 stability and activity through blocking the complex formation between p53 and MDM2.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22190034 2011 Global landscape of HIV-human protein complexes.
21269460 2011 Initial characterization of the human central proteome.
20661446 2010 Differential impact of tetratricopeptide repeat proteins on the steroid hormone receptors.
19946888 2010 Defining the membrane proteome of NK cells.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18620420 2008 Role of the cochaperone Tpr2 in Hsp90 chaperoning.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
16381901 2006 The LIFEdb database in 2006.
15592455 2005 Immunoaffinity profiling of tyrosine phosphorylation in cancer cells.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14573755 2003 Cytoplasmic accumulation of the nuclear receptor CAR by a tetratricopeptide repeat protein in HepG2 cells.
12853476 2003 Cofactor Tpr2 combines two TPR domains and a J domain to regulate the Hsp70/Hsp90 chaperone system.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11573955 2001 The J domain of Tpr2 regulates its interaction with the proapoptotic and cell-cycle checkpoint protein, Rad9.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11147971 2000 Mammalian HSP40/DNAJ homologs: cloning of novel cDNAs and a proposal for their classification and nomenclature.
11076863 2000 DNA cloning using in vitro site-specific recombination.
10567422 1999 Specific interaction of the 70-kDa heat shock cognate protein with the tetratricopeptide repeats.
8836031 1996 Identification and characterization of two novel tetratricopeptide repeat-containing genes.