Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.20
PubTator Score 0.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7950 3.1e-06

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma 1.141 3.1e-06

AA Sequence

MSTVKEAAHRLSKSEMSLYAVLDLKKGASPEDFKKSYSHSALLPHPPFEYHLGRKLALRYHPDKNPGNAQ      1 - 70
AAEIFKEINAAHAILSDSKKRKIYDQHGSLGIYLYDHFGEEGVRYYFILNSCWFKTLVILCTLLTCCCFC     71 - 140
CCCCFCCGALKPPPEQDSGRKYQQNVQSQPPRSGAKCDFRSEENSEDDF                         141 - 189
//

Text Mined References (4)

PMID Year Title