Property Summary

NCBI Gene PubMed Count 43
PubMed Score 92.51
PubTator Score 141.29

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
adult high grade glioma -1.500 3.6e-05
astrocytic glioma -1.200 1.5e-02
Astrocytoma, Pilocytic -1.100 2.7e-06
atypical teratoid / rhabdoid tumor -1.900 3.8e-09
ependymoma -1.400 1.0e-11
glioblastoma -1.200 5.8e-07
medulloblastoma -1.200 2.1e-07
medulloblastoma, large-cell -2.000 8.7e-07
osteosarcoma -2.214 1.1e-06
ovarian cancer 2.000 4.6e-08
primitive neuroectodermal tumor -1.200 3.3e-04
subependymal giant cell astrocytoma -1.180 1.1e-02

Gene RIF (20)

AA Sequence

MADQRQRSLSTSGESLYHVLGLDKNATSDDIKKSYRKLALKYHPDKNPDNPEAADKFKEINNAHAILTDA      1 - 70
TKRNIYDKYGSLGLYVAEQFGEENVNTYFVLSSWWAKALFVFCGLLTCCYCCCCLCCCFNCCCGKCKPKA     71 - 140
PEGEETEFYVSPEDLEAQLQSDEREATDTPIVIQPASATETTQLTADSHPSYHTDGFN                141 - 198
//

Text Mined References (56)

PMID Year Title