Property Summary

NCBI Gene PubMed Count 10
PubMed Score 1.61
PubTator Score 1.36

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma -2.000 4.9e-07
intraductal papillary-mucinous carcinoma... -1.200 4.1e-03
intraductal papillary-mucinous neoplasm ... -1.200 2.5e-02
ovarian cancer 1.700 2.6e-05

Synonym

Accession Q9NNZ3 O14716
Symbols HSPF2
MCG18
DANJC4

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (4)

PMID Text
20877624 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MPPLLPLRLCRLWPRNPPSRLLGAAAGQRSRPSTYYELLGVHPGASTEEVKRAFFSKSKELHPDRDPGNP      1 - 70
SLHSRFVELSEAYRVLSREQSRRSYDDQLRSGSPPKSPRTTVHDKSAHQTHSSWTPPNAQYWSQFHSVRP     71 - 140
QGPQLRQQQHKQNKQVLGYCLLLMLAGMGLHYIAFRKVKQMHLNFMDEKDRIITAFYNEARARARANRGI    141 - 210
LQQERQRLGQRQPPPSEPTQGPEIVPRGAGP                                           211 - 241
//

Text Mined References (10)

PMID Year Title
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
17500595 2007 Huntingtin interacting proteins are genetic modifiers of neurodegeneration.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11147971 2000 Mammalian HSP40/DNAJ homologs: cloning of novel cDNAs and a proposal for their classification and nomenclature.
9473517 1998 Characterisation of a new human and murine member of the DnaJ family of proteins.