Property Summary

NCBI Gene PubMed Count 29
PubMed Score 23.53
PubTator Score 23.16

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
Rheumatoid Arthritis 3.700 2.4e-03
psoriasis -1.300 9.7e-03
osteosarcoma 4.524 4.6e-09
ependymoma 1.300 1.4e-05
atypical teratoid / rhabdoid tumor 1.700 4.1e-05
glioblastoma 1.600 1.6e-04
medulloblastoma, large-cell 1.600 4.3e-04
juvenile dermatomyositis 1.183 1.1e-10
acute quadriplegic myopathy 1.266 8.8e-06
pancreatic ductal adenocarcinoma liver m... -2.188 3.4e-03
active Crohn's disease 1.578 2.7e-02
sarcoidosis 1.200 1.1e-02
diabetes mellitus -1.300 3.8e-03
pediatric high grade glioma 1.100 2.9e-03
subependymal giant cell astrocytoma 1.536 1.3e-02
Alzheimer's disease 1.600 3.1e-02
Pick disease 2.700 6.5e-05
ulcerative colitis 1.300 6.4e-06
ovarian cancer 2.700 3.4e-06
pituitary cancer -2.000 2.1e-03

Protein-protein Interaction (6)

Gene RIF (10)

PMID Text
25466870 Loss-of-function DNAJC3 mutations lead to a monogenic, recessive form of diabetes mellitus in humans.
25329545 p58IPK is a general inhibitor of the eIF2alpha kinases in that it also interacts with GCN2. Thus forced overexpression of cytoplasmic p58 delays eIF2alpha phosphorylation, suppresses GCN2 phosphorylation and prolongs protein synthesis
24134518 p58(IPK) suppresses coxsackievirus B3-induced apoptosis through selective activation of PI3K/Akt pathway that requires activation of ATF6a and subsequently upregulates mitofusin 2.
22064321 interplay between p38 phosphorylation and p58(IPK) upregulation has key roles in modulating ERp29-induced cell-growth arrest and survival
21799829 the crystal structure of human P58(IPK)
20554776 Coxsackievirus B3 infection induces apoptosis through downregulation of p58IPK and activation of CHOP and SREBP1.
20237496 Observational study of gene-disease association. (HuGE Navigator)
18568130 The study demonstrates that P58(IPK) inhibits endoplasmic reticulum (ER) stress and plays an important role in maintaining balance and stability of the ER in human retinal capillary endothelial cells.
12601012 P58(IPK) is an important component of a negative feedback loop used by the cell to inhibit eIF2alpha signaling, and thus attenuate the unfolded protein response.
12034040 Spleen cells from transgenic mice overexpressing (Hu)PKR were studied and compared to those from wild-type mice after drug treatment. Dact-treated spleen cells were resistant to apoptosis; ConA-treated cells had decreased cell division.

AA Sequence

MVAPGSVTSRLGSVFPFLLVLVDLQYEGAECGVNADVEKHLELGKKLLAAGQLADALSQFHAAVDGDPDN      1 - 70
YIAYYRRATVFLAMGKSKAALPDLTKVIQLKMDFTAARLQRGHLLLKQGKLDEAEDDFKKVLKSNPSENE     71 - 140
EKEAQSQLIKSDEMQRLRSQALNAFGSGDYTAAIAFLDKILEVCVWDAELRELRAECFIKEGEPRKAISD    141 - 210
LKAASKLKNDNTEAFYKISTLYYQLGDHELSLSEVRECLKLDQDHKRCFAHYKQVKKLNKLIESAEELIR    211 - 280
DGRYTDATSKYESVMKTEPSIAEYTVRSKERICHCFSKDEKPVEAIRVCSEVLQMEPDNVNALKDRAEAY    281 - 350
LIEEMYDEAIQDYETAQEHNENDQQIREGLEKAQRLLKQSQKRDYYKILGVKRNAKKQEIIKAYRKLALQ    351 - 420
WHPDNFQNEEEKKKAEKKFIDIAAAKEVLSDPEMRKKFDDGEDPLDAESQQGGGGNPFHRSWNSWQGFNP    421 - 490
FSSGGPFRFKFHFN                                                            491 - 504
//

Text Mined References (33)

PMID Year Title
26091039 2015 A Single Kinase Generates the Majority of the Secreted Phosphoproteome.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25466870 2014 Absence of BiP co-chaperone DNAJC3 causes diabetes mellitus and multisystemic neurodegeneration.
25329545 2015 p58IPK is an inhibitor of the eIF2? kinase GCN2 and its localization and expression underpin protein synthesis and ER processing capacity.
24769233 2014 Proteomic analysis of cerebrospinal fluid extracellular vesicles: a comprehensive dataset.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24134518 2014 P58(IPK) inhibits coxsackievirus-induced apoptosis via the PI3K/Akt pathway requiring activation of ATF6a and subsequent upregulation of mitofusin 2.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22064321 2012 ERp29 induces breast cancer cell growth arrest and survival through modulation of activation of p38 and upregulation of ER stress protein p58IPK.
21799829 2011 The crystal structure of the human co-chaperone P58(IPK).
21269460 2011 Initial characterization of the human central proteome.
20554776 2010 Coxsackievirus B3 infection activates the unfolded protein response and induces apoptosis through downregulation of p58IPK and activation of CHOP and SREBP1.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
19946888 2010 Defining the membrane proteome of NK cells.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
18568130 2008 P58(IPK) inhibition of endoplasmic reticulum stress in human retinal capillary endothelial cells in vitro.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057823 2004 The DNA sequence and analysis of human chromosome 13.
12601012 2003 P58IPK, a novel endoplasmic reticulum stress-inducible protein and potential negative regulator of eIF2alpha signaling.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12446838 2002 Control of PERK eIF2alpha kinase activity by the endoplasmic reticulum stress-induced molecular chaperone P58IPK.
12034040 2002 Expression of human PKR protein kinase in transgenic mice.
11991713 2002 An evaluation of the assembly of an approximately 15-Mb region on human chromosome 13q32-q33 linked to bipolar disorder and schizophrenia.
11939789 2002 Inactivation of the PKR protein kinase and stimulation of mRNA translation by the cellular co-chaperone P58(IPK) does not require J domain function.
11526399 2001 TIRAP: an adapter molecule in the Toll signaling pathway.
11147971 2000 Mammalian HSP40/DNAJ homologs: cloning of novel cDNAs and a proposal for their classification and nomenclature.
9920933 1999 The cellular inhibitor of the PKR protein kinase, P58(IPK), is an influenza virus-activated co-chaperone that modulates heat shock protein 70 activity.
9447982 1998 Regulation of interferon-induced protein kinase PKR: modulation of P58IPK inhibitory function by a novel protein, P52rIPK.
8824808 1996 Chromosomal assignment of the gene encoding the human 58-kDa inhibitor (PRKRI) of the interferon-induced dsRNA-activated protein kinase to chromosome 13q32.
8824806 1996 Localization of two metabotropic glutamate receptor genes, GRM3 and GRM8, to human chromosome 7q.
8666242 1996 Cloning, expression, and cellular localization of the oncogenic 58-kDa inhibitor of the RNA-activated human and mouse protein kinase.
8576172 1996 The P58 cellular inhibitor complexes with the interferon-induced, double-stranded RNA-dependent protein kinase, PKR, to regulate its autophosphorylation and activity.
7511204 1994 The 58,000-dalton cellular inhibitor of the interferon-induced double-stranded RNA-activated protein kinase (PKR) is a member of the tetratricopeptide repeat family of proteins.