Property Summary

NCBI Gene PubMed Count 20
PubMed Score 38.16
PubTator Score 18.63

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (7)

Disease log2 FC p
malignant mesothelioma 1.300 5.7e-07
esophageal adenocarcinoma 1.300 2.9e-02
glioblastoma 1.200 6.6e-03
group 3 medulloblastoma 1.200 7.9e-04
Pick disease -1.200 3.1e-05
progressive supranuclear palsy -1.100 6.3e-03
ovarian cancer 1.800 4.5e-05

Gene RIF (9)

PMID Text
25361733 Zrf1 is transcriptional regulator of neural fate downstream of Id1 in embryonic stem cells.During embryonic stem cell differentiation, Id1 levels decrease allowing Zrf1 to activate neural genes.
24449271 Zrf1 plays an essential role in neural progenitor cell generation and maintenance
24292673 our data reveal that ZRF1 is a key transcriptional regulator in leukemia progression
22733129 ZRF1 regulates the INK4-ARF locus during cellular proliferation and senescence, and alterations in ZRF1 may contribute to tumorigenesis.
22433847 the majority of AML patients elicited a humoral immune response against the tumor antigen MPP11
21179169 At the onset of differentiation, ZRF1 specifically displaces polycomb-repressive complex 1 (PRC1) from chromatin and facilitates transcriptional activation
20231810 describe a novel epitope derived from the MPP11 antigen that has been recognized by human CD8+ CTL
16002468 MPP11 is localized to the cytosol and with Hsp70L1, forms the mammalian ribosome-associated complex.
15802566 concluded that Mpp11, an ortholog of yeast Zuo, is a ribosome-associated J protein; proposed that in metazoans, ribosome-associated Zuo and Mpp11 orthologs recruit cytosolic Hsc70 to short ribosome-bound nascent chains as they exit the ribosome

AA Sequence

MLLLPSAADGRGTAITHALTSASTLCQVEPVGRWFEAFVKRRNRNASASFQELEDKKELSEESEDEELQL      1 - 70
EEFPMLKTLDPKDWKNQDHYAVLGLGHVRYKATQRQIKAAHKAMVLKHHPDKRKAAGEPIKEGDNDYFTC     71 - 140
ITKAYEMLSDPVKRRAFNSVDPTFDNSVPSKSEAKDNFFEVFTPVFERNSRWSNKKNVPKLGDMNSSFED    141 - 210
VDIFYSFWYNFDSWREFSYLDEEEKEKAECRDERRWIEKQNRATRAQRKKEEMNRIRTLVDNAYSCDPRI    211 - 280
KKFKEEEKAKKEAEKKAKAEAKRKEQEAKEKQRQAELEAARLAKEKEEEEVRQQALLAKKEKDIQKKAIK    281 - 350
KERQKLRNSCKTWNHFSDNEAERVKMMEEVEKLCDRLELASLQCLNETLTSCTKEVGKAALEKQIEEINE    351 - 420
QIRKEKEEAEARMRQASKNTEKSTGGGGNGSKNWSEDDLQLLIKAVNLFPAGTNSRWEVIANYMNIHSSS    421 - 490
GVKRTAKDVIGKAKSLQKLDPHQKDDINKKAFDKFKKEHGVVPQADNATPSERFEGPYTDFTPWTTEEQK    491 - 560
LLEQALKTYPVNTPERWEKIAEAVPGRTKKDCMKRYKELVEMVKAKKAAQEQVLNASRAKK             561 - 621
//

Text Mined References (31)

PMID Year Title
25361733 2015 Direct interaction between Id1 and Zrf1 controls neural differentiation of embryonic stem cells.
24449271 2014 Zrf1 is required to establish and maintain neural progenitor identity.
24292673 2014 ZRF1 controls the retinoic acid pathway and regulates leukemogenic potential in acute myeloid leukemia.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22733129 2013 ZRF1 controls oncogene-induced senescence through the INK4-ARF locus.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22433847 2012 M-phase phosphoprotein 11 is a highly immunogenic tumor antigen in patients with acute myeloid leukemia.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
21179169 2010 Transcriptional activation of polycomb-repressed genes by ZRF1.
20231810 2010 Identification of a novel peptide derived from the M-phase phosphoprotein 11 (MPP11) leukemic antigen recognized by human CD8+ cytotoxic T lymphocytes.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18399720 2008 Control of apoptosis by asymmetric cell division.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17242690 2007 C/EBPalphap30 plays transcriptional regulatory roles distinct from C/EBPalphap42.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16002468 2005 The chaperones MPP11 and Hsp70L1 form the mammalian ribosome-associated complex.
15802566 2005 Human Mpp11 J protein: ribosome-tethered molecular chaperones are ubiquitous.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14696097 2004 mRNA expression of leukemia-associated antigens in patients with acute myeloid leukemia for the development of specific immunotherapies.
12853948 2003 The DNA sequence of human chromosome 7.
12800198 2003 Characterization of several leukemia-associated antigens inducing humoral immune responses in acute and chronic myeloid leukemia.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11034098 2000 A putative oncogenic role for MPP11 in head and neck squamous cell cancer.
8885239 1996 Identification of novel M phase phosphoproteins by expression cloning.