Property Summary

NCBI Gene PubMed Count 17
PubMed Score 13.30
PubTator Score 45.61

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8491 8.9e-05
breast carcinoma 1614 1.9e-03
Disease Target Count Z-score Confidence
Enlarged vestibular aqueduct 10 3.795 1.9
Hard palate cancer 11 3.624 1.8

Expression

  Differential Expression (2)

Disease log2 FC p
breast carcinoma 1.100 1.9e-03
ovarian cancer 1.300 8.9e-05

 GO Process (1)

Gene RIF (4)

PMID Text
26739057 This suggests that DNAJC14's folding activity normally modulates yellow fever virus NS3/4A/2K cleavage events to liberate appropriate levels of NS3 and NS4A and promote replication complex formation.
22915803 These findings support a novel model of DNAJC14 action that includes specific membrane targeting of both DNAJC14 and yellow fever virus replication proteins.
22815758 a molecular chaperone, DRiP78, that interacts with both CXCR4 and CCR5, but not the heterodimer formed by these receptors
21249176 DNAJC14 is required for yellow fever virus replication.

AA Sequence

MAQKHPGERGLYGAHHSGGASLRTLGPSVDPEIPSFSGLRDSAGTAPNGTRCLTEHSGPKHTQHPNPAHW      1 - 70
LDPSHGPPGGPGPPRDAEDPDQSETSSEEESGVDQELSKENETGNQKDGNSFLSIPSACNCQGTPGIPEG     71 - 140
PYSEGGNGSSSNFCHHCTSPALGEDELEEEYDDEESLKFPSDFSRVSSGKKPPSRRQRHRFPTKEDTREG    141 - 210
GRRDPRSPGRHRLGRKRSQADKRKGLGLWGAEELCQLGQAGFWWLIELLVLVGEYVETCGHLIYACRQLK    211 - 280
SSDLDLFRVWMGVWTGRLGGWAQVMFQFLSQGFYCGVGLFTRFLKLLGALLLLALALFLGFLQLGWRFLV    281 - 350
GLGDRLGWRDKATWLFSWLDSPALQRCLTLLRDSRPWQRLVRIVQWGWLELPWVKQNINRQGNAPVASGR    351 - 420
YCQPEEEVARLLTMAGVPEDELNPFHVLGVEATASDVELKKAYRQLAVMVHPDKNHHPRAEEAFKVLRAA    421 - 490
WDIVSNAEKRKEYEMKRMAENELSRSVNEFLSKLQDDLKEAMNTMMCSRCQGKHRRFEMDREPKSARYCA    491 - 560
ECNRLHPAEEGDFWAESSMLGLKITYFALMDGKVYDITEWAGCQRVGISPDTHRVPYHISFGSRIPGTRG    561 - 630
RQRATPDAPPADLQDFLSRIFQVPPGQMPNGNFFAAPQPAPGAAAASKPNSTVPKGEAKPKRRKKVRRPF    631 - 700
QR                                                                        701 - 702
//

Text Mined References (18)

PMID Year Title
26739057 2016 Chaperone-Assisted Protein Folding Is Critical for Yellow Fever Virus NS3/4A Cleavage and Replication.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22915803 2012 Flavivirus replication complex assembly revealed by DNAJC14 functional mapping.
22815758 2012 Dopamine receptor-interacting protein 78 acts as a molecular chaperone for CCR5 chemokine receptor signaling complex organization.
21249176 2011 Identification and characterization of the host protein DNAJC14 as a broadly active flavivirus replication modulator.
19946888 2010 Defining the membrane proteome of NK cells.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14993367 2001 Accessory proteins in the biogenesis of G protein-coupled receptors.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12768437 2003 Molecular cloning and characterization of a novel human J-domain protein gene (HDJ3) from the fetal brain.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12446598 2002 A polyaromatic caveolin-binding-like motif in the cytoplasmic tail of the type 1 receptor for angiotensin II plays an important role in receptor trafficking and signaling.
11984006 2002 The Chediak-Higashi protein interacts with SNARE complex and signal transduction proteins.
11331877 2001 Regulation of transport of the dopamine D1 receptor by a new membrane-associated ER protein.
11181995 2001 The sequence of the human genome.