Property Summary

NCBI Gene PubMed Count 10
PubMed Score 4.24
PubTator Score 6.61

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (29)

Disease log2 FC p
nephrosclerosis -1.153 1.6e-02
malignant mesothelioma -1.900 1.7e-06
astrocytoma -1.800 1.8e-04
ependymoma -3.300 4.2e-02
oligodendroglioma -1.300 3.1e-02
uncontrolled asthma 1.400 7.7e-03
glioblastoma -2.600 4.7e-04
osteosarcoma -1.103 1.4e-03
group 3 medulloblastoma -1.900 1.2e-02
cystic fibrosis 1.699 6.1e-06
atypical teratoid / rhabdoid tumor -3.600 8.3e-07
primitive neuroectodermal tumor -1.700 4.2e-02
adrenocortical carcinoma -2.104 4.6e-03
pancreatic ductal adenocarcinoma liver m... -2.704 5.4e-04
non-small cell lung cancer 1.250 8.6e-05
intraductal papillary-mucinous adenoma (... -1.700 2.7e-02
lung cancer 2.500 1.7e-03
active Crohn's disease 1.801 1.5e-02
interstitial cystitis 1.200 4.4e-03
adult high grade glioma -2.500 1.1e-04
subependymal giant cell astrocytoma -2.757 9.6e-04
lung adenocarcinoma 1.718 4.3e-03
lung carcinoma 4.700 1.7e-50
Pick disease -1.200 5.1e-03
invasive ductal carcinoma 2.900 4.1e-02
ulcerative colitis 1.300 3.8e-04
ovarian cancer -1.800 4.5e-06
pituitary cancer -1.300 1.2e-06
chronic rhinosinusitis 1.180 4.9e-02

Gene RIF (5)

PMID Text
25805104 High expression of DNAJC12 correlates with poor prognosis for rectal cancer.
24122553 the endogenous DNAJC12 and Hsc70 proteins interact in LNCaP cells.
17373700 Observational study of gene-disease association. (HuGE Navigator)
16391838 JDP1 is a estrogen target gene and that its expression might be used as a marker of the estrogen transactivation activity
16385451 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MDAILNYRSEDTEDYYTLLGCDELSSVEQILAEFKVRALECHPDKHPENPKAVETFQKLQKAKEILTNEE      1 - 70
SRARYDHWRRSQMSMPFQQWEALNDSVKTSMHWVVRGKKDLMLEESDKTHTTKMENEECNEQRERKKEEL     71 - 140
ASTAEKTEQKEPKPLEKSVSPQNSDSSGFADVNGWHLRFRWSKDAPSELLRKFRNYEI                141 - 198
//

Text Mined References (14)

PMID Year Title
25805104 2015 Overexpression of DNAJC12 predicts poor response to neoadjuvant concurrent chemoradiotherapy in patients with rectal cancer.
24122553 2014 The co-chaperone DNAJC12 binds to Hsc70 and is upregulated by endoplasmic reticulum stress.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21269460 2011 Initial characterization of the human central proteome.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17373700 2007 Association studies of 23 positional/functional candidate genes on chromosome 10 in late-onset Alzheimer's disease.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
16391838 2006 JDP1 (DNAJC12/Hsp40) expression in breast cancer and its association with estrogen receptor status.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10760603 2000 Characterization of JDP genes, an evolutionarily conserved J domain-only protein family, from human and moths.