Property Summary

NCBI Gene PubMed Count 7
PubMed Score 138.93
PubTator Score 129.69

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Cancer 2499 4.851 2.4
Myoma 12 3.963 2.0

Expression

 GO Function (1)

AA Sequence

MVDYYEVLGLQRYASPEDIKKAYHKVALKWHPDKNPENKEEAERKFKEVAEAYEVLSNDEKRDIYDKYGT      1 - 70
EGLNGGGSHFDDECEYGFTFHKPDDVFKEIFHERDPFSFHFFEDSLEDLLNRPGSSYGNRNRDAGYFFST     71 - 140
ASEYPIFEKFSSYDTGYTSQGSLGHEGLTSFSSLAFDNSGMDNYISVTTSDKIVNGRNINTKKIIESDQE    141 - 210
REAEDNGELTFFLVNSVANEEGFAKECSWRTQSFNNYSPNSHSSKHVSQYTFVDNDEGGISWVTSNRDPP    211 - 280
IFSAGVKEGGKRKKKKRKEVQKKSTKRNC                                             281 - 309
//

Text Mined References (7)

PMID Year Title