Property Summary

NCBI Gene PubMed Count 7
PubMed Score 138.93
PubTator Score 129.69

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Cancer 2499 4.851 2.4
Myoma 12 3.963 2.0

Expression

Synonym

Accession Q7Z6W7 Q2M220 Q5H904 Q8WYJ7
Symbols DJ5
HSC3

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 GO Function (1)

AA Sequence

MVDYYEVLGLQRYASPEDIKKAYHKVALKWHPDKNPENKEEAERKFKEVAEAYEVLSNDEKRDIYDKYGT      1 - 70
EGLNGGGSHFDDECEYGFTFHKPDDVFKEIFHERDPFSFHFFEDSLEDLLNRPGSSYGNRNRDAGYFFST     71 - 140
ASEYPIFEKFSSYDTGYTSQGSLGHEGLTSFSSLAFDNSGMDNYISVTTSDKIVNGRNINTKKIIESDQE    141 - 210
REAEDNGELTFFLVNSVANEEGFAKECSWRTQSFNNYSPNSHSSKHVSQYTFVDNDEGGISWVTSNRDPP    211 - 280
IFSAGVKEGGKRKKKKRKEVQKKSTKRNC                                             281 - 309
//

Text Mined References (7)

PMID Year Title