Property Summary

NCBI Gene PubMed Count 10
PubMed Score 1.64
PubTator Score 1.55

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
malignant mesothelioma 1.500 1.2e-05
oligodendroglioma 1.200 1.8e-02
osteosarcoma 1.234 1.5e-03
Duchenne muscular dystrophy -1.128 3.0e-05
acute quadriplegic myopathy -1.433 8.0e-05
tuberculosis -1.500 6.0e-06
intraductal papillary-mucinous carcinoma... -1.100 3.0e-04
colon cancer -1.700 2.4e-06

Synonym

Accession O75953 B3KN14 B4DSA6 J3KQM9 J3KR08 Q5T656 Q8TDR7 Q96EM4
Symbols Hsc40

Gene

PANTHER Protein Class (2)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MGKDYYKILGIPSGANEDEIKKAYRKMALKYHPDKNKEPNAEEKFKEIAEAYDVLSDPKKRGLYDQYGEE      1 - 70
GLKTGGGTSGGSSGSFHYTFHGDPHATFASFFGGSNPFDIFFASSRSTRPFSGFDPDDMDVDEDEDPFGA     71 - 140
FGRFGFNGLSRGPRRAPEPLYPRRKVQDPPVVHELRVSLEEIYHGSTKRMKITRRRLNPDGRTVRTEDKI    141 - 210
LHIVIKRGWKEGTKITFPKEGDATPDNIPADIVFVLKDKPHAHFRRDGTNVLYSALISLKEALCGCTVNI    211 - 280
PTIDGRVIPLPCNDVIKPGTVKRLRGEGLPFPKVPTQRGDLIVEFKVRFPDRLTPQTRQILKQHLPCS      281 - 348
//

Text Mined References (12)

PMID Year Title
23414517 2013 A human skeletal muscle interactome centered on proteins involved in muscular dystrophies: LGMD interactome.
22810586 2012 Interpreting cancer genomes using systematic host network perturbations by tumour virus proteins.
21231916 2011 The diverse members of the mammalian HSP70 machine show distinct chaperone-like activities.
21078624 2011 Comparison of an expanded ataxia interactome with patient medical records reveals a relationship between macular degeneration and ataxia.
18457437 2008 Identification of intracellular proteins associated with the EBV-encoded nuclear antigen 5 using an efficient TAP procedure and FT-ICR mass spectrometry.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11147971 2000 Mammalian HSP40/DNAJ homologs: cloning of novel cDNAs and a proposal for their classification and nomenclature.
10570961 1999 Hsc40, a new member of the hsp40 family, exhibits similar expression profile to that of hsc70 in mammalian cells.
7566098 1995 Initial assessment of human gene diversity and expression patterns based upon 83 million nucleotides of cDNA sequence.