Tbio | DnaJ homolog subfamily B member 4 |
Probable chaperone. Stimulates ATP hydrolysis and the folding of unfolded proteins mediated by HSPA1A/B (in vitro) (PubMed:24318877).
The protein encoded by this gene is a molecular chaperone, tumor suppressor, and member of the heat shock protein-40 family. The encoded protein binds the cell adhesion protein E-cadherin and targets it to the plasma membrane. This protein also binds incorrectly folded E-cadherin and targets it for endoplasmic reticulum-associated degradation. This gene is a strong tumor suppressor for colorectal carcinoma, and downregulation of it may serve as a good biomarker for predicting patient outcomes. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2015]
The protein encoded by this gene is a molecular chaperone, tumor suppressor, and member of the heat shock protein-40 family. The encoded protein binds the cell adhesion protein E-cadherin and targets it to the plasma membrane. This protein also binds incorrectly folded E-cadherin and targets it for endoplasmic reticulum-associated degradation. This gene is a strong tumor suppressor for colorectal carcinoma, and downregulation of it may serve as a good biomarker for predicting patient outcomes. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2015]
Comments
Disease | Target Count | P-value |
---|---|---|
lung adenocarcinoma | 2716 | 1.4e-11 |
non-small cell lung cancer | 2890 | 4.9e-11 |
Breast cancer | 3578 | 8.5e-10 |
ovarian cancer | 8520 | 8.7e-07 |
medulloblastoma, large-cell | 6241 | 1.7e-06 |
psoriasis | 6694 | 6.4e-06 |
malignant mesothelioma | 3232 | 1.0e-05 |
lung cancer | 4740 | 1.5e-05 |
intraductal papillary-mucinous carcinoma (IPMC) | 2989 | 5.4e-05 |
invasive ductal carcinoma | 2951 | 1.0e-04 |
tuberculosis | 2010 | 1.6e-04 |
atypical teratoid / rhabdoid tumor | 5112 | 7.6e-04 |
osteosarcoma | 7950 | 1.1e-03 |
intraductal papillary-mucinous neoplasm (IPMN) | 3291 | 1.2e-03 |
hereditary spastic paraplegia | 318 | 2.8e-03 |
acute myeloid leukemia | 783 | 3.3e-03 |
intraductal papillary-mucinous adenoma (IPMA) | 2955 | 5.5e-03 |
colon cancer | 1478 | 1.0e-02 |
group 3 medulloblastoma | 4104 | 3.3e-02 |
spina bifida | 1074 | 3.5e-02 |
Disease | log2 FC | p |
---|---|---|
acute myeloid leukemia | 1.900 | 3.3e-03 |
atypical teratoid / rhabdoid tumor | -1.300 | 7.6e-04 |
Breast cancer | -1.200 | 8.5e-10 |
colon cancer | -1.600 | 1.0e-02 |
group 3 medulloblastoma | -1.500 | 3.3e-02 |
hereditary spastic paraplegia | -1.090 | 2.8e-03 |
intraductal papillary-mucinous adenoma (... | -1.500 | 5.5e-03 |
intraductal papillary-mucinous carcinoma... | -2.500 | 5.4e-05 |
intraductal papillary-mucinous neoplasm ... | -2.300 | 1.2e-03 |
invasive ductal carcinoma | -1.500 | 1.0e-04 |
lung adenocarcinoma | -1.400 | 1.4e-11 |
lung cancer | -2.000 | 1.5e-05 |
malignant mesothelioma | -1.200 | 1.0e-05 |
medulloblastoma, large-cell | -2.200 | 1.7e-06 |
non-small cell lung cancer | -1.191 | 4.9e-11 |
osteosarcoma | 1.481 | 1.1e-03 |
ovarian cancer | -1.500 | 8.7e-07 |
psoriasis | -1.200 | 6.4e-06 |
spina bifida | -2.018 | 3.5e-02 |
tuberculosis | -1.700 | 1.6e-04 |
Species | Source | Disease |
---|---|---|
OMA EggNOG | ||
Inparanoid OMA EggNOG | ||
Inparanoid OMA EggNOG | ||
Inparanoid OMA | ||
Inparanoid OMA | ||
Inparanoid OMA | ||
Inparanoid OMA | ||
Inparanoid OMA | ||
Inparanoid OMA | ||
Inparanoid OMA | ||
Inparanoid OMA | ||
Inparanoid OMA |
MGKDYYCILGIEKGASDEDIKKAYRKQALKFHPDKNKSPQAEEKFKEVAEAYEVLSDPKKREIYDQFGEE 1 - 70 GLKGGAGGTDGQGGTFRYTFHGDPHATFAAFFGGSNPFEIFFGRRMGGGRDSEEMEIDGDPFSAFGFSMN 71 - 140 GYPRDRNSVGPSRLKQDPPVIHELRVSLEEIYSGCTKRMKISRKRLNADGRSYRSEDKILTIEIKKGWKE 141 - 210 GTKITFPREGDETPNSIPADIVFIIKDKDHPKFKRDGSNIIYTAKISLREALCGCSINVPTLDGRNIPMS 211 - 280 VNDIVKPGMRRRIIGYGLPFPKNPDQRGDLLIEFEVSFPDTISSSSKEVLRKHLPAS 281 - 337 //