Property Summary

NCBI Gene PubMed Count 25
PubMed Score 18.53
PubTator Score 21.58

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
acute myeloid leukemia 1.900 3.3e-03
atypical teratoid / rhabdoid tumor -1.300 7.6e-04
Breast cancer -1.200 8.5e-10
colon cancer -1.600 1.0e-02
group 3 medulloblastoma -1.500 3.3e-02
hereditary spastic paraplegia -1.090 2.8e-03
intraductal papillary-mucinous adenoma (... -1.500 5.5e-03
intraductal papillary-mucinous carcinoma... -2.500 5.4e-05
intraductal papillary-mucinous neoplasm ... -2.300 1.2e-03
invasive ductal carcinoma -1.500 1.0e-04
lung adenocarcinoma -1.400 1.4e-11
lung cancer -2.000 1.5e-05
malignant mesothelioma -1.200 1.0e-05
medulloblastoma, large-cell -2.200 1.7e-06
non-small cell lung cancer -1.191 4.9e-11
osteosarcoma 1.481 1.1e-03
ovarian cancer -1.500 8.7e-07
psoriasis -1.200 6.4e-06
spina bifida -2.018 3.5e-02
tuberculosis -1.700 1.6e-04

Protein-protein Interaction (6)

Gene RIF (13)

AA Sequence

MGKDYYCILGIEKGASDEDIKKAYRKQALKFHPDKNKSPQAEEKFKEVAEAYEVLSDPKKREIYDQFGEE      1 - 70
GLKGGAGGTDGQGGTFRYTFHGDPHATFAAFFGGSNPFEIFFGRRMGGGRDSEEMEIDGDPFSAFGFSMN     71 - 140
GYPRDRNSVGPSRLKQDPPVIHELRVSLEEIYSGCTKRMKISRKRLNADGRSYRSEDKILTIEIKKGWKE    141 - 210
GTKITFPREGDETPNSIPADIVFIIKDKDHPKFKRDGSNIIYTAKISLREALCGCSINVPTLDGRNIPMS    211 - 280
VNDIVKPGMRRRIIGYGLPFPKNPDQRGDLLIEFEVSFPDTISSSSKEVLRKHLPAS                 281 - 337
//

Text Mined References (30)

PMID Year Title