Property Summary

NCBI Gene PubMed Count 33
PubMed Score 35.70
PubTator Score 21.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (5)

Disease log2 FC p
pancreatic ductal adenocarcinoma liver m... -1.922 4.2e-02
non-small cell lung cancer 1.180 5.7e-20
diabetes mellitus -1.100 3.2e-02
ovarian cancer 2.500 1.5e-06
Breast cancer 1.400 1.3e-05

Synonym

Accession Q9UBS4 Q542Y5 Q542Y9 Q6IAQ8 Q96JC6
Symbols DJ9
EDJ
Dj-9
ERj3
ABBP2
ERdj3
ERj3p
ABBP-2
UNQ537
PRO1080

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 MGI Phenotype (1)

Protein-protein Interaction (11)

Gene RIF (17)

PMID Text
26085089 BiP facilitates Sec61 channel closure (i.e. limits ER Ca(2+) leakage) via the Sec61 channel with the help of ERj3 and ERj6
25361606 regulated co-secretion of ERdj3 with misfolded clients directly links ER and extracellular proteostasis during conditions of ER stress.
25143379 ERdj3 mutant bound to unfolded endoplasmic reticulum proteins under steady state conditions in much greater amounts than wild-type.
25126989 Depleting ERdj3 reduced the rate of mutant GCase degradation in patient-derived fibroblasts, while increasing folding, trafficking, and function by directing GCase to the profolding ER calnexin pathway.
23378021 ERdjs appear to play the dual roles of increasing BiP affinity for clients and regulating delivery of clients to BiP.
22190034 HIV-1 gp120 is identified to have a physical interaction with DnaJ (Hsp40) homolog, subfamily B, member 11 (DNAJB11) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
21844235 These data identify ERdj3 as a host protein involved with the cholera toxin intoxication process and provide new molecular details regarding cholera toxin A1-chaperone interactions.
21673190 In addition, BiP formed a complex with SV40 capsids in the endoplasmic reticulum in a DNAJB11-dependent fashion.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20418907 Hsp90 and Hsp40/Erdj3 were essential for K1's anti-apoptotic function.
20335166 The Salmonella type III secretion effector, salmonella leucine-rich repeat protein (SlrP), targets the human chaperone ERdj3.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19748898 Hsp40 ERdj3 requires its Hsp70 interaction and substrate-binding properties to complement various yeast Hsp40-dependent functions
17976514 These findings suggest that the Cys-rich region of HEDJ and its oxidation state are important in maintaining the substrate interaction domain in a binding-competent conformation.
15544163 These data suggest that ERdj3 might have diverse roles in the ER, including that of the molecular cochaperone of BiP and an as yet unknown protective action against vero toxin.(ERDJ3)
15525676 ERdj3 is a stress-inducible endoplasmic reticulum DnaJ homologue which serves as a cofactor for BiP's interactions with unfolded substrates
15195998 This protein was identified as true homolog of yeast Scj1p.

AA Sequence

MAPQNLSTFCLLLLYLIGAVIAGRDFYKILGVPRSASIKDIKKAYRKLALQLHPDRNPDDPQAQEKFQDL      1 - 70
GAAYEVLSDSEKRKQYDTYGEEGLKDGHQSSHGDIFSHFFGDFGFMFGGTPRQQDRNIPRGSDIIVDLEV     71 - 140
TLEEVYAGNFVEVVRNKPVARQAPGKRKCNCRQEMRTTQLGPGRFQMTQEVVCDECPNVKLVNEERTLEV    141 - 210
EIEPGVRDGMEYPFIGEGEPHVDGEPGDLRFRIKVVKHPIFERRGDDLYTNVTISLVESLVGFEMDITHL    211 - 280
DGHKVHISRDKITRPGAKLWKKGEGLPNFDNNNIKGSLIITFDVDFPKEQLTEEAREGIKQLLKQGSVQK    281 - 350
VYNGLQGY                                                                  351 - 358
//

Text Mined References (38)

PMID Year Title
26085089 2015 Co-chaperone Specificity in Gating of the Polypeptide Conducting Channel in the Membrane of the Human Endoplasmic Reticulum.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25361606 2015 Unfolded protein response-induced ERdj3 secretion links ER stress to extracellular proteostasis.
25143379 2014 Dissection of structural and functional requirements that underlie the interaction of ERdj3 protein with substrates in the endoplasmic reticulum.
25126989 2014 ERdj3 is an endoplasmic reticulum degradation factor for mutant glucocerebrosidase variants linked to Gaucher's disease.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24189400 2013 Perturbation of the mutated EGFR interactome identifies vulnerabilities and resistance mechanisms.
23378021 2013 ERdj3 regulates BiP occupancy in living cells.
21844235 2011 Structural and functional interactions between the cholera toxin A1 subunit and ERdj3/HEDJ, a chaperone of the endoplasmic reticulum.
21673190 2011 BiP and multiple DNAJ molecular chaperones in the endoplasmic reticulum are required for efficient simian virus 40 infection.
21269460 2011 Initial characterization of the human central proteome.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20418907 2010 Hsp90 and Hsp40/Erdj3 are required for the expression and anti-apoptotic function of KSHV K1.
20335166 2010 The Salmonella type III secretion effector, salmonella leucine-rich repeat protein (SlrP), targets the human chaperone ERdj3.
19946888 2010 Defining the membrane proteome of NK cells.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19748898 2009 The mammalian Hsp40 ERdj3 requires its Hsp70 interaction and substrate-binding properties to complement various yeast Hsp40-dependent functions.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
18923428 2008 Regulated release of ERdj3 from unfolded proteins by BiP.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17976514 2007 Contribution of the HEDJ/ERdj3 cysteine-rich domain to substrate interactions.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
16236267 2005 Proteomic analysis of SUMO4 substrates in HEK293 cells under serum starvation-induced stress.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
16130169 2005 Proteomics of human umbilical vein endothelial cells applied to etoposide-induced apoptosis.
15544163 2004 Localization and function in endoplasmic reticulum stress tolerance of ERdj3, a new member of Hsp40 family protein.
15525676 2005 ERdj3, a stress-inducible endoplasmic reticulum DnaJ homologue, serves as a cofactor for BiP's interactions with unfolded substrates.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15195998 2004 Characterization of pancreatic ERj3p, a homolog of yeast DnaJ-like protein Scj1p.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12475965 2002 A subset of chaperones and folding enzymes form multiprotein complexes in endoplasmic reticulum to bind nascent proteins.
11584023 2001 A DnaJ protein, apobec-1-binding protein-2, modulates apolipoprotein B mRNA editing.
11147971 2000 Mammalian HSP40/DNAJ homologs: cloning of novel cDNAs and a proposal for their classification and nomenclature.
10827079 2000 HEDJ, an Hsp40 co-chaperone localized to the endoplasmic reticulum of human cells.