Property Summary

NCBI Gene PubMed Count 75
PubMed Score 367.94
PubTator Score 95.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.176 4.3e-02
Multiple myeloma 1.230 4.4e-03
esophageal adenocarcinoma -1.500 1.9e-02
psoriasis 1.200 1.7e-06
glioblastoma 2.500 1.5e-02
astrocytoma 1.300 3.2e-02
tuberculosis -1.300 8.8e-03
primary pancreatic ductal adenocarcinoma 1.397 2.6e-02
intraductal papillary-mucinous adenoma (... 1.100 1.0e-02
pancreatic cancer 1.500 1.7e-02
group 4 medulloblastoma -1.100 4.7e-03
spina bifida -1.277 4.1e-02
chronic rhinosinusitis -1.021 4.0e-02

Synonym

Accession P25685 B4DX52
Symbols Hdj1
Sis1
HSPF1
Hsp40
RSPH16B

Gene

PANTHER Protein Class (2)

PDB

4WB7   1HDJ   2QLD   3AGX   3AGY   3AGZ  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 MGI Phenotype (1)

Gene RIF (45)

PMID Text
26505878 DNAJB1-PRKACA was evaluated as a key driver of fibrolamellar carcinoma and as a candidate therapeutic target
26336106 siRNA experiments confirmed that a reduction in Hsp27 or Hsp40 rescued CFTR in the DeltaF508 mutant, but the rescue was not additive or synergistic with C4 + 18 treatment, indicating these correctors shared a common pathway for rescue
26239118 study provides a new molecular mechanism to regulate EGFR signaling through modulation of MIG6 by DNAJB1 as a negative regulator.
25557953 In this cohort of fibrolamellar hepatocellular carcinoma, almost 80% contained the DNAJB1-PRKACA fusion transcript.
25472883 HIV-1 Tat specifically associates with DNAJB1 promoter to upregulate DNAJB1 expression in T cells
25444898 Authors identified DNAJB1 as a negative regulator of PDCD5-mediated apoptosis and found that the apoptosis network of PDCD5 regulates cancer cell death.
25122662 Whole exome sequencing followed by immunohistochemistry of fibrolamellar hepatocellular carcinoma cell lines and tumors showed two structural variants resulting in fusion transcripts: DNAJB1-PRKCA and CLPTM1L-GLIS3.
25058638 We also found that, despite an initial report to the contrary, the human homolog of Sis1, Hdj1, is capable of [PSI+] prion propagation in place of Sis1
24658033 HSP40 interacts with pyruvate kinase M2 and regulates glycolysis and cell proliferation in tumor cells.
24578576 Evidence supporting the presence of the DNAJB1-PRKACA chimeric transcript in 100% of the FL-HCCs examined (15/15) suggests that this genetic alteration contributes to tumor pathogenesis.
24361594 we discovered a new MDM2 interacting protein, DNAJB1, and provided evidence to support its p53-dependent tumor suppressor function.
24318877 we combined the Hsp70-NEF pairs with cochaperones of the J protein family (DnaJA1, DnaJA2, DnaJB1, and DnaJB4) to generate 16 permutations.
24309468 Studies with specific phosphoantibodies indicate that MK5 phosphorylates Hsp40/DnaJB1 in vivo at Ser-149 or/and Ser-151 and Ser-171 in the C-terminal domain of Hsp40/DnaJB1.
24196953 Httex1 overstretches the protein quality control resources and that the defects can be partly rescued by overexpression of hsp40 and hsp70.
24091676 HSP40 and HSP110 function together in protein homeostasis control.
24047968 HIV-1 Tat specifically associates with DNAJB1 promoter to upregulate DNAJB1 expression in T cells
23962724 Results show that TDP-43 is constitutively bound to members of the Hsp40/Hsp70 family, and that heat shock-induced TDP-43 aggregation is mediated by the availability of these chaperones interacting with the inherently disordered C-terminal prion domain.
23400395 There was a positive correlation between DnaJB1 and severity of pulmonary arterial hypertension in peripheral blood mononuclear cells from patients with limited cutaneous systemic sclerosis.
23395854 methionine deprivation results in an antioxidant response that includes an increase in the levels of HSPA1A and DNAJB1 mRNA
22075554 Hsp40 regulates the amount of keratin proteins via ubiquitin-proteasome pathway.
22022600 Mammalian Hsp110 (Apg-2), Hsp70 (Hsc70 or Hsp70) and Hsp40 (Hdj1) were necessary and sufficient to slowly dissolve large disordered aggregates and recover natively folded protein
21763498 Differential expression of Hsp40 and Hsp70 reciprocally regulates viral gene expression and replication in HIV-1 infection.
21698289 Cellular localization studies showed that NP and Hsp40 co-localize primarily in the nucleus. During IAV infection in mammalian cells, expression of NP coincided with the dissociation of P58(IPK) from Hsp40 and decrease PKR phosphorylation
21639839 Chaperone activity of proteins Hsp70 and Hdj1 in human leukemia u-937 cells were increased after heat shock.
21480956 HSF1 and major HSP's are expressed strongly in classical Hodgkin lymphoma.
21249176 The antiviral activity of overexpressed DNAJC14 occurs in a time- and dose-dependent manner.
21139202 The crystal structure of full-length Hdj1 was diffracted to 3.90A resolution.
20809635 Determined are crystal structures of the C-terminal peptide-binding domain of human Hsp40 Hdj1 (CTD) and of its complex with the C-terminal octapeptide of human Hsp70, (634')GPTIEEVD(641').
20735358 Data show that HSP70, GRP78/BiP and HSP40/DnaJ each independently suppressed hA misfolding.
20084477 Hsp70B' also formed complexes with Hsp40 suggesting a common co-chaperone for HSP70 family members.
20026329 Data show that GM significantly suppressed refolding of firefly luciferase in the presence of HSP70 and HSP40.
19901540 5-fluorouracil & carboplatin specifically induce expression of Hsp40 in hepatoma cells. siRNA knockdown of Hsp40 diminishes survival of drug-exposed cells.
19254810 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18977241 Observational study of gene-disease association. (HuGE Navigator)
18211704 The 2.7A structure reveals that Hdj1 forms a homodimer in the crystal by a crystallographic two-fold axis.
18187620 HIV-1 Tat specifically associates with DNAJB1 promoter to upregulate DNAJB1 expression in T cells
18187620 Knockdown of DnaJ (Hsp40) homolog, subfamily B, member 1 (DNAJB1) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
18032501 These results demonstrate a role for Hsp40/DnaJB6 in the regulation of HIV-2 PIC nuclear transport.
17601350 Observational study of gene-disease association. (HuGE Navigator)
16842747 hepatitis B virus X protein is the major target of Hdj1 in the inhibition of hepatitis B virus replication
16179353 Hsp40 is crucial for Nef-mediated enhancement of viral gene expression and replication
16179353 HIV-1 Tat specifically associates with DNAJB1 promoter to upregulate DNAJB1 expression in T cells
15362566 It is confirmed an increased expression of HSPF1 in the lymphoblastoid cell lines from patients with bipolar I disorder, bipolar II disorder, and schizophrenia.
15194794 sequestered in discrete foci in the nucleus of the infected cell in herpes simplex virus type 1 infection
14743183 Altered expression of HSPF1 was found in brains and lymphoblastoid cells from patients with bipolar disorder.

AA Sequence

MGKDYYQTLGLARGASDEEIKRAYRRQALRYHPDKNKEPGAEEKFKEIAEAYDVLSDPRKREIFDRYGEE      1 - 70
GLKGSGPSGGSGGGANGTSFSYTFHGDPHAMFAEFFGGRNPFDTFFGQRNGEEGMDIDDPFSGFPMGMGG     71 - 140
FTNVNFGRSRSAQEPARKKQDPPVTHDLRVSLEEIYSGCTKKMKISHKRLNPDGKSIRNEDKILTIEVKK    141 - 210
GWKEGTKITFPKEGDQTSNNIPADIVFVLKDKPHNIFKRDGSDVIYPARISLREALCGCTVNVPTLDGRT    211 - 280
IPVVFKDVIRPGMRRKVPGEGLPLPKTPEKRGDLIIEFEVIFPERIPQTSRTVLEQVLPI              281 - 340
//

Text Mined References (81)

PMID Year Title
27120771 2016 Polyhydramnios, Transient Antenatal Bartter's Syndrome, and MAGED2 Mutations.
26505878 2016 The DNAJB1-PRKACA chimera: Candidate biomarker and therapeutic target for fibrolamellar carcinomas.
26336106 2015 Combination of Correctors Rescue ?F508-CFTR by Reducing Its Association with Hsp40 and Hsp27.
26239118 2015 DNAJB1 negatively regulates MIG6 to promote epidermal growth factor receptor signaling.
25557953 2015 Unique genomic profile of fibrolamellar hepatocellular carcinoma.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25444898 2015 DNAJB1 destabilizes PDCD5 to suppress p53-mediated apoptosis.
25122662 2015 Genomic analysis of fibrolamellar hepatocellular carcinoma.
25058638 2014 Functional diversification of hsp40: distinct j-protein functional requirements for two prions allow for chaperone-dependent prion selection.
24658033 2014 HSP40 interacts with pyruvate kinase M2 and regulates glycolysis and cell proliferation in tumor cells.
24578576 2014 Detection of a recurrent DNAJB1-PRKACA chimeric transcript in fibrolamellar hepatocellular carcinoma.
24361594 2014 DNAJB1 stabilizes MDM2 and contributes to cancer cell proliferation in a p53-dependent manner.
24318877 2014 Binding of human nucleotide exchange factors to heat shock protein 70 (Hsp70) generates functionally distinct complexes in vitro.
24309468 2014 Phosphorylation of heat shock protein 40 (Hsp40/DnaJB1) by mitogen-activated protein kinase-activated protein kinase 5 (MK5/PRAK).
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24196953 2013 A platform to view huntingtin exon 1 aggregation flux in the cell reveals divergent influences from chaperones hsp40 and hsp70.
24091676 2013 Suppression of polyglutamine protein toxicity by co-expression of a heat-shock protein 40 and a heat-shock protein 110.
23962724 2014 Prion-like nuclear aggregation of TDP-43 during heat shock is regulated by HSP40/70 chaperones.
23921388 2013 Identification and characterization of a novel human methyltransferase modulating Hsp70 protein function through lysine methylation.
23400395 2013 Increased expression of endoplasmic reticulum stress and unfolded protein response genes in peripheral blood mononuclear cells from patients with limited cutaneous systemic sclerosis and pulmonary arterial hypertension.
23395854 2013 Activation of the antioxidant response in methionine deprived human cells results in an HSF1-independent increase in HSPA1A mRNA levels.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22075554 2012 Hsp40 regulates the amount of keratin proteins via ubiquitin-proteasome pathway in cultured human cells.
22022600 2011 The mammalian disaggregase machinery: Hsp110 synergizes with Hsp70 and Hsp40 to catalyze protein disaggregation and reactivation in a cell-free system.
21763498 2011 Reciprocal regulation of human immunodeficiency virus-1 gene expression and replication by heat shock proteins 40 and 70.
21698289 2011 Influenza A virus nucleoprotein exploits Hsp40 to inhibit PKR activation.
21639839 2011 Kinetics of chaperone activity of proteins Hsp70 and Hdj1 in human leukemia u-937 cells after preconditioning with thermal shock or compound u-133.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21480956 2011 Expression of heat shock proteins in classical Hodgkin lymphoma: correlation with apoptotic pathways and prognostic significance.
21269460 2011 Initial characterization of the human central proteome.
21249176 2011 Identification and characterization of the host protein DNAJC14 as a broadly active flavivirus replication modulator.
21231916 2011 The diverse members of the mammalian HSP70 machine show distinct chaperone-like activities.
21139202 2010 Purification, crystallization and preliminary X-ray crystallographic analysis of the human heat-shock protein 40 Hdj1 and its C-terminal peptide-binding domain.
21044950 2011 Genome-wide YFP fluorescence complementation screen identifies new regulators for telomere signaling in human cells.
20809635 2010 Peptide-binding sites as revealed by the crystal structures of the human Hsp40 Hdj1 C-terminal domain in complex with the octapeptide from human Hsp70.
20735358 2010 The chaperone proteins HSP70, HSP40/DnaJ and GRP78/BiP suppress misfolding and formation of ?-sheet-containing aggregates by human amylin: a potential role for defective chaperone biology in Type 2 diabetes.
20084477 2010 Heteromeric complexes of heat shock protein 70 (HSP70) family members, including Hsp70B', in differentiated human neuronal cells.
20060297 2010 Chaperone-assisted selective autophagy is essential for muscle maintenance.
20026329 2010 Gentamicin inhibits HSP70-assisted protein folding by interfering with substrate recognition.
19901540 2009 Inhibition of Hsp27 and Hsp40 potentiates 5-fluorouracil and carboplatin mediated cell killing in hepatoma cells.
19254810 2009 The glucocorticoid receptor heterocomplex gene STIP1 is associated with improved lung function in asthmatic subjects treated with inhaled corticosteroids.
19240134 2009 Regulation of SR protein phosphorylation and alternative splicing by modulating kinetic interactions of SRPK1 with molecular chaperones.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18977241 2008 Oxidative stress, telomere length and biomarkers of physical aging in a cohort aged 79 years from the 1932 Scottish Mental Survey.
18620420 2008 Role of the cochaperone Tpr2 in Hsp90 chaperoning.
18211704 2008 The crystal structure of the putative peptide-binding fragment from the human Hsp40 protein Hdj1.
18032501 2008 Hsp40 facilitates nuclear import of the human immunodeficiency virus type 2 Vpx-mediated preintegration complex.
17601350 2007 A genetic association analysis of cognitive ability and cognitive ageing using 325 markers for 109 genes associated with oxidative stress or cognition.
17024176 2006 A novel HSF1-mediated death pathway that is suppressed by heat shock proteins.
16842747 2006 Turnover of hepatitis B virus X protein is facilitated by Hdj1, a human Hsp40/DnaJ protein.
16179353 2005 Heat shock protein 40 is necessary for human immunodeficiency virus-1 Nef-mediated enhancement of viral gene expression and replication.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15362566 2004 Expression of HSPF1 and LIM in the lymphoblastoid cells derived from patients with bipolar disorder and schizophrenia.
15194794 2004 Nuclear sequestration of cellular chaperone and proteasomal machinery during herpes simplex virus type 1 infection.
15075330 2004 Isoform specificity among ankyrins. An amphipathic alpha-helix in the divergent regulatory domain of ankyrin-b interacts with the molecular co-chaperone Hdj1/Hsp40.
15057824 2004 The DNA sequence and biology of human chromosome 19.
14752510 2004 hsp70-DnaJ chaperone pair prevents nitric oxide- and CHOP-induced apoptosis by inhibiting translocation of Bax to mitochondria.
14743183 2004 Molecular characterization of bipolar disorder by comparing gene expression profiles of postmortem brains of major mental disorders.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14503850 2003 Cooperative interaction of Hsp40 and TPR1 with Hsp70 reverses Hsp70-HspBp1 complex formation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11821413 2002 Interaction of the molecular chaperone Hsp70 with human NAD(P)H:quinone oxidoreductase 1.
11809754 2002 HSP40 binding is the first step in the HSP90 chaperoning pathway for the progesterone receptor.
11500375 2001 FANCC interacts with Hsp70 to protect hematopoietic cells from IFN-gamma/TNF-alpha-mediated cytotoxicity.
11457725 2001 Specific association of nitric oxide synthase-2 with Rac isoforms in activated murine macrophages.
11147971 2000 Mammalian HSP40/DNAJ homologs: cloning of novel cDNAs and a proposal for their classification and nomenclature.
10816573 2000 Human DnaJ homologs dj2 and dj3, and bag-1 are positive cochaperones of hsc70.
10593983 1999 Heat shock protein (Hsp) 40 mutants inhibit Hsp70 in mammalian cells.
10330192 1999 Identification of CHIP, a novel tetratricopeptide repeat-containing protein that interacts with heat shock proteins and negatively regulates chaperone functions.
9920933 1999 The cellular inhibitor of the PKR protein kinase, P58(IPK), is an influenza virus-activated co-chaperone that modulates heat shock protein 70 activity.
9727490 1998 Repression of heat shock transcription factor HSF1 activation by HSP90 (HSP90 complex) that forms a stress-sensitive complex with HSF1.
9545528 1998 Characterization of HSE sequences in human Hsp40 gene: structural and promoter analysis.
9499401 1998 Molecular chaperones as HSF1-specific transcriptional repressors.
8975727 1996 Genomic cloning of a human heat shock protein 40 (Hsp40) gene (HSPF1) and its chromosomal localization to 19p13.2.
8764402 1996 Nuclear magnetic resonance solution structure of the human Hsp40 (HDJ-1) J-domain.
8670798 1996 The human cytosolic molecular chaperones hsp90, hsp70 (hsc70) and hdj-1 have distinct roles in recognition of a non-native protein and protein refolding.
8250930 1993 Cloning of a cDNA for heat-shock protein hsp40, a human homologue of bacterial DnaJ.
1754405 1991 A human homologue of the Escherichia coli DnaJ heat-shock protein.
1586970 1992 Intracellular localization and partial amino acid sequence of a stress-inducible 40-kDa protein in HeLa cells.