Property Summary

NCBI Gene PubMed Count 56
PubMed Score 42.76
PubTator Score 39.84

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (2)

Disease log2 FC p
pancreatic ductal adenocarcinoma liver m... -1.213 2.2e-03
ovarian cancer 1.200 8.0e-03

 GWAS Trait (1)

Gene RIF (27)

PMID Text
26245905 The Role of the Phylogenetically Conserved Cochaperone Protein Droj2/DNAJA3 in NF-kappaB Signaling.
26055714 Tid1 increases autophagic flux by interacting with the Beclin 1-containing autophagy protein complex.
25904328 Impaired stoichiometry between mtHsp40 and mtHsp70 promotes Opa1L cleavage, leading to cristae opening, decreased OXPHOS, and triggering of mitochondrial fragmentation after reduction in their chaperone function.
24492964 TID1 prevents complex I aggregation and support the existence of a TID1-mediated stress response to ATP synthase inhibition
23698466 Tid1 acts as a tumor suppressor by inhibiting EGFR signaling through interaction with EGFR/HSP70/HSP90 and enhancing EGFR ubiquitinylation and degradation.
22692211 loss of hTid-1(S) expression in the basal layer of skin epidermis correlates with the enhanced HSP27 phosphorylation, keratinocyte hyperproliferation, and excess actin cytoskeleton organization in lesional psoriatic skin
22595283 Data show that elevated DnaJA3 induces dynamin-related protein 1 (Drp1)-depedendent mitochondrial fragmentation and decreased cell viability.
21710689 Tid1 and CHIP play pivotal roles in affecting the levels of ErbB2 protein, and that both are significant prognostic indicators of breast cancer patient survival.
21242965 findings denote hTid-1(S) as an essential regulatory component of MetR signaling
21106534 hTid1 negatively regulates the expression and transcriptional activity of STAT5b and suppresses the growth of hematopoietic cells transformed by an oncogenic form of STAT5b.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20800603 Observational study of gene-disease association. (HuGE Navigator)
20565727 htid is a tissue independent and evolutionarily conserved suppressor of ErbB-2.
19900451 amino-terminal segment of APC promotes cell sensitivity to apoptosis modulated through its binding to 40- and 43-kilodalton hTID-1 isoforms.
18097612 The expression of the genes htid-1 and APC was altered in colorectal tumors.
17588722 The association of the endogenous Tid50/Tid48 proteins with the adenomatous polyposis coli (APC) tumor suppressor is shown.
16531398 The association of Tid1 with chaperones and/or protein substrates in the cytosol provides a mechanism for the alternate fates and functions of Tid1 in mitochondrial and nonmitochondrial pathways.
16518412 hTid1 may act as a chaperone to facilitate the folding, processing and maturation of Epstein-Barr virus-encoded BARF1 protein.
16204048 Tid1 negatively regulates the motility and metastasis of breast cancer cells, most likely through attenuation of nuclear factor kappaB activity on the promoter of the IL8 gene.
15879105 Tid1 is critical for the transition of double-negative to double-positive cells in early T cell development through modulation of antiapoptotic bcl-2 expression.
15805242 Tid-1(L) may play a critical role in pVHL-mediated tumor suppression by modulating the pVHL-dependent HIF-1alpha stability.
15753086 the carboxyl-terminal end of TID1 (residues 224-429) bound to Trk at the activation loop (Tyr(P)(683)-Tyr(684)(P)(684)
15601829 hTid-1 represses the activity of NF-kappaB through physical and functional interactions with the IKK complex and IkappaB
15589840 findings suggest that the status of hTid-1 in gliomas may contribute to their susceptibility to cell death triggers
15156195 an important cell death regulator and could exert tumor suppressor activity
12879007 Tid-1S in Th2 cells following activation has a role in induction of apoptosis resistance during the activation of Th2 cells
11927590 role as a repressor of Ikappa B kinase beta subunit

AA Sequence

MAARCSTRWLLVVVGTPRLPAISGRGARPPREGVVGAWLSRKLSVPAFASSLTSCGPRALLTLRPGVSLT      1 - 70
GTKHNPFICTASFHTSAPLAKEDYYQILGVPRNASQKEIKKAYYQLAKKYHPDTNKDDPKAKEKFSQLAE     71 - 140
AYEVLSDEVKRKQYDAYGSAGFDPGASGSQHSYWKGGPTVDPEELFRKIFGEFSSSSFGDFQTVFDQPQE    141 - 210
YFMELTFNQAAKGVNKEFTVNIMDTCERCNGKGNEPGTKVQHCHYCGGSGMETINTGPFVMRSTCRRCGG    211 - 280
RGSIIISPCVVCRGAGQAKQKKRVMIPVPAGVEDGQTVRMPVGKREIFITFRVQKSPVFRRDGADIHSDL    281 - 350
FISIAQALLGGTARAQGLYETINVTIPPGTQTDQKIRMGGKGIPRINSYGYGDHYIHIKIRVPKRLTSRQ    351 - 420
QSLILSYAEDETDVEGTVNGVTLTSSGGSTMDSSAGSKARREAGEDEEGFLSKLKKMFTS              421 - 480
//

Text Mined References (60)

PMID Year Title
26245905 2015 The Role of the Phylogenetically Conserved Cochaperone Protein Droj2/DNAJA3 in NF-?B Signaling.
26055714 2015 Tid1, the Mammalian Homologue of Drosophila Tumor Suppressor Tid56, Mediates Macroautophagy by Interacting with Beclin1-containing Autophagy Protein Complex.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25904328 2015 Stoichiometric expression of mtHsp40 and mtHsp70 modulates mitochondrial morphology and cristae structure via Opa1L cleavage.
25416956 2014 A proteome-scale map of the human interactome network.
24492964 2014 Essential role of TID1 in maintaining mitochondrial membrane potential homogeneity and mitochondrial DNA integrity.
23698466 2013 Tid1-L inhibits EGFR signaling in lung adenocarcinoma by enhancing EGFR Ubiquitinylation and degradation.
23455924 2013 A Y2H-seq approach defines the human protein methyltransferase interactome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22692211 2012 Absence of a human DnaJ protein hTid-1S correlates with aberrant actin cytoskeleton organization in lesional psoriatic skin.
22595283 2012 Mitochondrial chaperone DnaJA3 induces Drp1-dependent mitochondrial fragmentation.
21710689 2011 Tid1, CHIP and ErbB2 interactions and their prognostic implications for breast cancer patients.
21311096 2010 Direct interaction between p53 and Tid1 proteins affects p53 mitochondrial localization and apoptosis.
21269460 2011 Initial characterization of the human central proteome.
21242965 2011 hTID-1 defines a novel regulator of c-Met Receptor signaling in renal cell carcinomas.
21231916 2011 The diverse members of the mammalian HSP70 machine show distinct chaperone-like activities.
21106534 2011 The tumor suppressor hTid1 inhibits STAT5b activity via functional interaction.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
20565727 2010 In vivo evidence of htid suppressive activity on ErbB-2 in breast cancers over expressing the receptor.
20053669 2010 Role of Magmas in protein transport and human mitochondria biogenesis.
19935715 2010 Tid1 is a new regulator of p53 mitochondrial translocation and apoptosis in cancer.
19900451 2010 The mitochondrial protein hTID-1 partners with the caspase-cleaved adenomatous polyposis cell tumor suppressor to facilitate apoptosis.
19681071 2009 Tid1 functions as a tumour suppressor in head and neck squamous cell carcinoma.
19038220 2008 A mammalian homolog of Drosophila tumorous imaginal discs, Tid1, mediates agrin signaling at the neuromuscular junction.
18097612 2008 Progression of colorectal cancers correlates with overexpression and loss of polarization of expression of the htid-1 tumor suppressor.
18063578 2008 The layered structure of human mitochondrial DNA nucleoids.
17588722 2007 Htid-1, the human homolog of the Drosophila melanogaster l(2)tid tumor suppressor, defines a novel physiological role of APC.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16531398 2006 Tid1 isoforms are mitochondrial DnaJ-like chaperones with unique carboxyl termini that determine cytosolic fate.
16518412 2006 Biochemical and functional characterization of Epstein-Barr virus-encoded BARF1 protein: interaction with human hTid1 protein facilitates its maturation and secretion.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16204048 2005 Tid1 negatively regulates the migratory potential of cancer cells by inhibiting the production of interleukin-8.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15879105 2005 Tid1 is required for T cell transition from double-negative 3 to double-positive stages.
15805242 2005 Tid-1 interacts with the von Hippel-Lindau protein and modulates angiogenesis by destabilization of HIF-1alpha.
15753086 2005 Human tumorous imaginal disc 1 (TID1) associates with Trk receptor tyrosine kinases and regulates neurite outgrowth in nnr5-TrkA cells.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15601829 2005 Molecular mechanism of hTid-1, the human homolog of Drosophila tumor suppressor l(2)Tid, in the regulation of NF-kappaB activity and suppression of tumor growth.
15589840 2004 Identification of a hTid-1 mutation which sensitizes gliomas to apoptosis.
15546961 2005 Novel interaction partners of the TPR/MET tyrosine kinase.
15520177 2004 Tid1, the human homologue of a Drosophila tumor suppressor, reduces the malignant activity of ErbB-2 in carcinoma cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15231748 2004 Functional proteomics mapping of a human signaling pathway.
15156195 2004 Depletion of physiological levels of the human TID1 protein renders cancer cell lines resistant to apoptosis mediated by multiple exogenous stimuli.
14993262 2004 Tid1, a cochaperone of the heat shock 70 protein and the mammalian counterpart of the Drosophila tumor suppressor l(2)tid, is critical for early embryonic development and cell survival.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12879007 2003 TID1, a mammalian homologue of the drosophila tumor suppressor lethal(2) tumorous imaginal discs, regulates activation-induced cell death in Th2 cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12118383 2002 Isolation and characterization of a novel gene, hRFI, preferentially expressed in esophageal cancer.
12097419 2002 Large scale identification of human hepatocellular carcinoma-associated antigens by autoantibodies.
11719219 2001 Human T cell leukemia virus type 1 Tax associates with a molecular chaperone complex containing hTid-1 and Hsp70.
11707338 2001 Genomic organization and expression of the human tumorous imaginal disc (TID1) gene.
11679576 2001 hTid-1, a human DnaJ protein, modulates the interferon signaling pathway.
11147971 2000 Mammalian HSP40/DNAJ homologs: cloning of novel cDNAs and a proposal for their classification and nomenclature.
11116152 2001 A mouse homologue of the Drosophila tumor suppressor l(2)tid gene defines a novel Ras GTPase-activating protein (RasGAP)-binding protein.
11005857 2000 Tid1/Rdh54 promotes colocalization of rad51 and dmc1 during meiotic recombination.
10411904 1999 TID1, a human homolog of the Drosophila tumor suppressor l(2)tid, encodes two mitochondrial modulators of apoptosis with opposing functions.
9683573 1998 A novel human DnaJ protein, hTid-1, a homolog of the Drosophila tumor suppressor protein Tid56, can interact with the human papillomavirus type 16 E7 oncoprotein.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.