Property Summary

NCBI Gene PubMed Count 25
PubMed Score 16.65
PubTator Score 19.44

Knowledge Summary


No data available


  Differential Expression (3)

Disease log2 FC p
posterior fossa group B ependymoma 2.000 4.4e-11
lung carcinoma -2.400 2.5e-09
psoriasis -1.500 3.0e-35

Gene RIF (10)

22184204 Mutations in DNAH11 are a common cause of PCD in patients without ciliary ultrastructural defects; thus, genetic analysis can be used to ascertain the diagnosis of PCD in this challenging group of patients.
20513915 mutations: splice site in acceptor splice site of exon 5 and nonsense mutation located in exon 23 for DNAH11 in primary ciliary dyskinesia
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19410201 Two "major" genes, DNAI1 and DNAH5, underlie PCD in nearly half of the patients with ODA defects
19060911 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
18492703 Observational study of gene-disease association. (HuGE Navigator)
18022865 These findings support the view that DNAH11 mutations indeed cause Primary ciliary dyskinesia and Kartagener syndrome, and that the reported DNAH11 nonsense mutations are associated with a normal axonemal ultrastructure.
15375157 a specific requirement for p150(Glued)/dynein/functional microtubules in activation of MKK3/6 and p38 MAPKs in vivo.
15304525 Dynein plays an unexpected role in the regulation of mitochondrial morphology in living cells, by controlling the recruitment of Drp1 to these organelles.
12142464 mutations in the DNAH11 gene cause one form of situs inversus totalis and most likely primary ciliary dyskinesia

AA Sequence

YRTKLRGPSYIWTFRLKSEEKTAKWVLAGVALLLEA                                     4481 - 4516

Text Mined References (25)

PMID Year Title
25186273 2014 Ciliary beat pattern and frequency in genetic variants of primary ciliary dyskinesia.
24468470 2014 Genetic susceptibility to accelerated cognitive decline in the US Health and Retirement Study.
24360805 2014 Mutations in DNAH1, which encodes an inner arm heavy chain dynein, lead to male infertility from multiple morphological abnormalities of the sperm flagella.
24097068 2013 Discovery and refinement of loci associated with lipid levels.
23502783 2013 The CCND1 c.870G>A polymorphism is a risk factor for t(11;14)(q13;q32) multiple myeloma.
23103227 2012 Genetic variants at 6p21.1 and 7p15.3 are associated with risk of multiple cancers in Han Chinese.
22499950 2012 High prevalence of respiratory ciliary dysfunction in congenital heart disease patients with heterotaxy.
22184204 2012 Mutations of DNAH11 in patients with primary ciliary dyskinesia with normal ciliary ultrastructure.
22120009 2011 Common variation at 3p22.1 and 7p15.3 influences multiple myeloma risk.
21116278 2011 Genome-wide association with MRI atrophy measures as a quantitative trait locus for Alzheimer's disease.
20686565 2010 Biological, clinical and population relevance of 95 loci for blood lipids.
20513915 2010 New DNAH11 mutations in primary ciliary dyskinesia with normal axonemal ultrastructure.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19410201 2009 Ciliary defects and genetics of primary ciliary dyskinesia.
19060911 2009 Loci influencing lipid levels and coronary heart disease risk in 16 European population cohorts.
18492703 2008 Mutations in dynein genes in patients affected by isolated non-syndromic asthenozoospermia.
18022865 2008 Primary ciliary dyskinesia associated with normal axoneme ultrastructure is caused by DNAH11 mutations.
15375157 2004 p150(Glued), Dynein, and microtubules are specifically required for activation of MKK3/6 and p38 MAPKs.
15304525 2004 Cytoplasmic dynein regulates the subcellular distribution of mitochondria by controlling the recruitment of the fission factor dynamin-related protein-1.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12853948 2003 The DNA sequence of human chromosome 7.
12142464 2002 Mutations in the DNAH11 (axonemal heavy chain dynein type 11) gene cause one form of situs inversus totalis and most likely primary ciliary dyskinesia.
10737800 2000 Shotgun sequencing of the human transcriptome with ORF expressed sequence tags.
9325061 1997 Chromosomal mapping of two members of the human dynein gene family to chromosome regions 7p15 and 11q13 near the deafness loci DFNA 5 and DFNA 11.
9256245 1997 Isolation of several human axonemal dynein heavy chain genes: genomic structure of the catalytic site, phylogenetic analysis and chromosomal assignment.