Property Summary

NCBI Gene PubMed Count 11
PubMed Score 11.71
PubTator Score 8.68

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (7)

Disease log2 FC p
chronic rhinosinusitis -1.196 4.1e-02
ependymoma 1.300 1.3e-03
group 3 medulloblastoma -1.200 1.5e-02
lung carcinoma -1.500 1.9e-04
nasopharyngeal carcinoma -1.300 5.2e-08
pituitary cancer -1.100 1.4e-04
tuberculosis -2.100 1.5e-05

 GO Function (1)

Gene RIF (4)

AA Sequence

MHPEPSEPATGGAAELDCAQEPGVEESAGDHGSAGRGGCKEEINDPKEICVGSSDTSYHSQQKQSGDNGS      1 - 70
GGHFAHPREDREDRGPRMTKSSLQKLCKQHKLYITPALNDTLYLHFKGFDRIENLEEYTGLRCLWLQSNG     71 - 140
IQKIENLEAQTELRCLFLQMNLLRKIENLEPLQKLDALNLSNNYIKTIENLSCLPVLNTLQMAHNHLETV    141 - 210
EDIQHLQECLRLCVLDLSHNKLSDPEILSILESMPDLRVLNLMGNPVIRQIPNYRRTVTVRLKHLTYLDD    211 - 280
RPVFPKDRACAEAWARGGYAAEKEERQQWESRERKKITDSIEALAMIKQRAEERKRQRESQERGEMTSSD    281 - 350
DGENVPASAEGKEEPPGDRETRQKMELFVKESFEAKDELCPEKPSGEEPPVEAKREDGGPEPEGTLPAET    351 - 420
LLLSSPVEVKGEDGDGEPEGTLPAEAPPPPPPVEVKGEDGDQEPEGTLPAETLLLSPPVKVKGEDGDREP    421 - 490
EGTLPAEAPPPPPLGAAREEPTPQAVATEGVFVTELDGTRTEDLETIRLETKETFCIDDLPDLEDDDETG    491 - 560
KSLEDQNMCFPKIEVISSLSDDSDPELDYTSLPVLENLPTDTLSNIFAVSKDTSKAARVPFTDIFKKEAK    561 - 630
RDLEIRKQDTKSPRPLIQELSDEDPSGQLLMPPTCQRDAAPLTSSGDRDSDFLAASSPVPTESAATPPET    631 - 700
CVGVAQPSQALPTWDLTAFPAPKAS                                                 701 - 725
//

Text Mined References (13)

PMID Year Title