Property Summary

NCBI Gene PubMed Count 27
PubMed Score 239.30
PubTator Score 165.17

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
malignant mesothelioma 2.000 2.4e-06
group 3 medulloblastoma 1.400 8.7e-03
medulloblastoma, large-cell 1.200 1.1e-03
primitive neuroectodermal tumor 1.100 3.7e-03
lung cancer 1.500 6.6e-05
colon cancer 1.100 2.9e-02
nasopharyngeal carcinoma 1.500 1.5e-06
non-small cell lung carcinoma 1.100 1.1e-19
Breast cancer 1.600 1.6e-16
ovarian cancer 1.300 4.0e-04
psoriasis 1.200 3.6e-49

Gene RIF (19)

PMID Text
25909997 BRCA1 and CtIP contribute to DSB resection by recruiting Dna2 to damage sites, thus ensuring the robust DSB resection necessary for efficient homologous recombination.
25733713 EXO1, MRE11, and CtIP are not involved in the same mechanism of reversed fork processing, whereas human RECQ1 limits DNA2 activity by preventing extensive nascent strand degradation.
25238049 depletion of DNA2 in cells reduces proliferation, addition of estrogen restores proliferation. cells responding to estrogen will proliferate despite impaired in DNA2 activity, potentially promoting genomic instability and triggering cancer development.
25200081 DNA2 stimulates the helicase activity of BLM.
25122754 WRN and BLM act epistatically with DNA2 to promote the long-range resection of double strand break ends in human cells.
24626199 The suppression of FANCD2(-/-) by DNA2 knockdowns suggests that DNA2 and FANCD2 also have antagonistic roles: in the absence of FANCD2, DNA2 somehow corrupts repair.
23352259 These results implicate human DNA2 and the long-patch base-excision repair pathway in the pathogenesis of adult-onset disorders of mtDNA maintenance.
22987153 DNA2 interacts with FANCD2, and cisplatin induces FANCD2 ubiquitylation even in the absence of DNA2.
22570476 analysis of Okazaki fragment processing-independent role for human Dna2 enzyme during DNA replication
22570407 A characterization of the substrate specificities influencing hDna2 binding and cleavage functions and the sequential interaction of hFEN1 and hDna2 on Okazaki fragment intermediates.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20131965 reviews the evidence for the dynamic design of Okazaki fragment processing and the roles of Dna2 and its interacting partners in carrying out this design. [REVIEW]
20019387 Acetylation of Dna2 endonuclease/helicase and flap endonuclease 1 by p300 promotes DNA stability by creating long flap intermediates.
19487465 Data indicate that hDna2 is similar to its yeast counterpart and is a new addition to the growing list of proteins that participate in both nuclear and mitochondrial DNA maintenance.
18995831 studies illustrate an evolutionarily diversified role of hDNA2 in mitochondrial DNA replication and repair in a mammalian system.
18593712 Replication protein A stimulates the 5'- to 3'-nuclease activity of Dna2 and inhibits the 3'- to 5'-exo/endonuclease activity of Dna2.
17032657 report here two novel activities of both the yeast and human Dna2 helicase/nuclease protein: single strand annealing and ATP-independent strand exchange on short duplexes
16595800 hDna2 showed ATPase/helicase activity and 5'-3' exo-endonuclease as well as 3'-5' exo-endonuclease activity, indicating that its biochemical properties are very similar to yeast DNA2.
16595799 The purified human Dna2 enzyme contains intrinsic endonuclease and DNA-dependent ATPase activities, but is devoid of detectable DNA helicase activity.

AA Sequence

MEQLNELELLMEKSFWEEAELPAELFQKKVVASFPRTVLSTGMDNRYLVLAVNTVQNKEGNCEKRLVITA      1 - 70
SQSLENKELCILRNDWCSVPVEPGDIIHLEGDCTSDTWIIDKDFGYLILYPDMLISGTSIASSIRCMRRA     71 - 140
VLSETFRSSDPATRQMLIGTVLHEVFQKAINNSFAPEKLQELAFQTIQEIRHLKEMYRLNLSQDEIKQEV    141 - 210
EDYLPSFCKWAGDFMHKNTSTDFPQMQLSLPSDNSKDNSTCNIEVVKPMDIEESIWSPRFGLKGKIDVTV    211 - 280
GVKIHRGYKTKYKIMPLELKTGKESNSIEHRSQVVLYTLLSQERRADPEAGLLLYLKTGQMYPVPANHLD    281 - 350
KRELLKLRNQMAFSLFHRISKSATRQKTQLASLPQIIEEEKTCKYCSQIGNCALYSRAVEQQMDCSSVPI    351 - 420
VMLPKIEEETQHLKQTHLEYFSLWCLMLTLESQSKDNKKNHQNIWLMPASEMEKSGSCIGNLIRMEHVKI    421 - 490
VCDGQYLHNFQCKHGAIPVTNLMAGDRVIVSGEERSLFALSRGYVKEINMTTVTCLLDRNLSVLPESTLF    491 - 560
RLDQEEKNCDIDTPLGNLSKLMENTFVSKKLRDLIIDFREPQFISYLSSVLPHDAKDTVACILKGLNKPQ    561 - 630
RQAMKKVLLSKDYTLIVGMPGTGKTTTICTLVRILYACGFSVLLTSYTHSAVDNILLKLAKFKIGFLRLG    631 - 700
QIQKVHPAIQQFTEQEICRSKSIKSLALLEELYNSQLIVATTCMGINHPIFSRKIFDFCIVDEASQISQP    701 - 770
ICLGPLFFSRRFVLVGDHQQLPPLVLNREARALGMSESLFKRLEQNKSAVVQLTVQYRMNSKIMSLSNKL    771 - 840
TYEGKLECGSDKVANAVINLRHFKDVKLELEFYADYSDNPWLMGVFEPNNPVCFLNTDKVPAPEQVEKGG    841 - 910
VSNVTEAKLIVFLTSIFVKAGCSPSDIGIIAPYRQQLKIINDLLARSIGMVEVNTVDKYQGRDKSIVLVS    911 - 980
FVRSNKDGTVGELLKDWRRLNVAITRAKHKLILLGCVPSLNCYPPLEKLLNHLNSEKLIIDLPSREHESL    981 - 1050
CHILGDFQRE                                                               1051 - 1060
//

Text Mined References (29)

PMID Year Title
25909997 2015 BRCA1 and CtIP Are Both Required to Recruit Dna2 at Double-Strand Breaks in Homologous Recombination.
25733713 2015 DNA2 drives processing and restart of reversed replication forks in human cells.
25238049 2014 The DNA2 nuclease/helicase is an estrogen-dependent gene mutated in breast and ovarian cancers.
25200081 2014 Multifaceted role of the Topo III?-RMI1-RMI2 complex and DNA2 in the BLM-dependent pathway of DNA break end resection.
25122754 2014 DNA2 cooperates with the WRN and BLM RecQ helicases to mediate long-range DNA end resection in human cells.
24626199 2014 Preventing over-resection by DNA2 helicase/nuclease suppresses repair defects in Fanconi anemia cells.
24389050 2014 Genomic analysis of primordial dwarfism reveals novel disease genes.
23604072 2013 Mammalian DNA2 helicase/nuclease cleaves G-quadruplex DNA and is required for telomere integrity.
23352259 2013 Mutations in DNA2 link progressive myopathy to mitochondrial DNA instability.
22987153 2012 DNA2 and EXO1 in replication-coupled, homology-directed repair and in the interplay between HDR and the FA/BRCA network.
22570476 2012 Okazaki fragment processing-independent role for human Dna2 enzyme during DNA replication.
22570407 2012 Biochemical analyses indicate that binding and cleavage specificities define the ordered processing of human Okazaki fragments by Dna2 and FEN1.
21572043 2011 Characterization of the endonuclease and ATP-dependent flap endo/exonuclease of Dna2.
21325134 2011 BLM-DNA2-RPA-MRN and EXO1-BLM-RPA-MRN constitute two DNA end resection machineries for human DNA break repair.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20131965 2010 Dna2 on the road to Okazaki fragment processing and genome stability in eukaryotes.
20019387 2010 Acetylation of Dna2 endonuclease/helicase and flap endonuclease 1 by p300 promotes DNA stability by creating long flap intermediates.
19487465 2009 Human Dna2 is a nuclear and mitochondrial DNA maintenance protein.
18995831 2008 Human DNA2 is a mitochondrial nuclease/helicase for efficient processing of DNA replication and repair intermediates.
18593712 2008 Processing of G4 DNA by Dna2 helicase/nuclease and replication protein A (RPA) provides insights into the mechanism of Dna2/RPA substrate recognition.
17032657 2006 Single strand annealing and ATP-independent strand exchange activities of yeast and human DNA2: possible role in Okazaki fragment maturation.
16595800 2006 Biochemical analysis of human Dna2.
16595799 2006 Isolation of human Dna2 endonuclease and characterization of its enzymatic properties.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11473323 2001 RPA governs endonuclease switching during processing of Okazaki fragments in eukaryotes.
8938459 1996 Assignment of the closest human homologue (DNA2L:KIAA0083) of the yeast Dna2 helicase gene to chromosome band 10q21.3-q22.1.
7788527 1995 Prediction of the coding sequences of unidentified human genes. III. The coding sequences of 40 new genes (KIAA0081-KIAA0120) deduced by analysis of cDNA clones from human cell line KG-1.