Property Summary

NCBI Gene PubMed Count 14
PubMed Score 56.10
PubTator Score 6.64

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (5)

Disease log2 FC p
astrocytic glioma 1.200 3.7e-02
psoriasis -1.400 1.1e-04
osteosarcoma 1.606 4.9e-05
atypical teratoid / rhabdoid tumor 1.200 3.4e-04
group 3 medulloblastoma -1.300 1.4e-02

Synonym

Accession Q09019
Symbols DMRN9
DMR-N9
gene59
D19S593E

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MAAGGAEGGSGPGAAMGDCAEIKSQFRTREGFYKLLPGDGAARRSGPASAQTPVPPQPPQPPPGPASASG      1 - 70
PGAAGPASSPPPAGPGPGPALPAVRLSLVRLGEPDSAGAGEPPATPAGLGSGGDRVCFNLGRELYFYPGC     71 - 140
CRRGSQRSIDLNKPIDKRIYKGTQPTCHDFNQFTAATETISLLVGFSAGQVQYLDLIKKDTSKLFNEERL    141 - 210
IDKTKVTYLKWLPESESLFLASHASGHLYLYNVSHPCASAPPQYSLLKQGEGFSVYAAKSKAPRNPLAKW    211 - 280
AVGEGPLNEFAFSPDGRHLACVSQDGCLRVFHFDSMLLRGLMKSYFGGLLCVCWSPDGRYVVTGGEDDLV    281 - 350
TVWSFTEGRVVARGHGHKSWVNAVAFDPYTTRAEEAATAAGADGERSGEEEEEEPEAAGTGSAGGAPLSP    351 - 420
LPKAGSITYRFGSAGQDTQFCLWDLTEDVLYPHPPLARTRTLPGTPGTTPPAASSSRGGEPGPGPLPRSL    421 - 490
SRSNSLPHPAGGGKAGGPGVAAEPGTPFSIGRFATLTLQERRDRGAEKEHKRYHSLGNISRGGSGGSGSG    491 - 560
GEKPSGPVPRSRLDPAKVLGTALCPRIHEVPLLEPLVCKKIAQERLTVLLFLEDCIITACQEGLICTWAR    561 - 630
PGKAFTDEETEAQTGEGSWPRSPSKSVVEGISSQPGNSPSGTVV                              631 - 674
//

Text Mined References (17)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
16751776 2006 A germline-specific class of small RNAs binds mammalian Piwi proteins.
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15057824 2004 The DNA sequence and biology of human chromosome 19.
14526185 2003 Transgenic mouse models for myotonic dystrophy type 1 (DM1).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11592825 Effect of triplet repeat expansion on chromatin structure and expression of DMPK and neighboring genes, SIX5 and DMWD, in myotonic dystrophy.
11527424 2001 Decreased DMPK transcript levels in myotonic dystrophy 1 type IIA muscle fibers.
10400997 1999 Myotonic dystrophy is associated with a reduced level of RNA from the DMWD allele adjacent to the expanded repeat.
9872056 1998 Expanding complexity in myotonic dystrophy.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8499920 1993 Structure and genomic sequence of the myotonic dystrophy (DM kinase) gene.
7905855 1993 Genomic organization and transcriptional units at the myotonic dystrophy locus.
7633444 1995 Structural organization and developmental expression pattern of the mouse WD-repeat gene DMR-N9 immediately upstream of the myotonic dystrophy locus.
1302022 1992 Characterization of the myotonic dystrophy region predicts multiple protein isoform-encoding mRNAs.