Property Summary

NCBI Gene PubMed Count 24
PubMed Score 22.75
PubTator Score 11.18

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
ovarian cancer 8491 4.3e-07
Pick disease 1893 2.9e-06
progressive supranuclear palsy 674 7.6e-03
ependymoma 2514 1.6e-02
astrocytic glioma 2241 2.0e-02
Disease Target Count Z-score Confidence
Mood disorder 10 0.0 1.0
Disease Target Count Z-score Confidence
Dental caries 67 4.607 2.3
Dental fluorosis 16 4.327 2.2

Expression

  Differential Expression (5)

Disease log2 FC p
astrocytic glioma 1.400 2.0e-02
ependymoma 1.200 1.6e-02
Pick disease -1.600 2.9e-06
progressive supranuclear palsy -1.400 7.6e-03
ovarian cancer -1.400 4.3e-07

Gene RIF (10)

PMID Text
26187004 findings imply that DMP1alpha- and beta-ratios are tightly regulated in hematopoietic cells and DMP1beta antagonizes DMP1alpha transcriptional regulation of ARF resulting in the alteration of cellular control with a gain in proliferation
25965824 Low DMTF1 expression is associated with in bladder cancer.
23938323 This study reveals a pivotal role of combined Dmp1 loss and cyclin D1 overexpression in breast cancer.
23045280 LOH for hDMP1 was associated with luminal A category and longer relapse-free survival
22331460 new mechanism of p53 activation mediated by direct physical interaction between Dmp1 and p53.
20351715 Meta-analysis and genome-wide association study of gene-disease association. (HuGE Navigator)
17972942 WT1 downregulation during myeloid differentiation of NB4 and HL60 leukemic cell lines is associated with increased tumor repressor hDMP1 mRNA levels
17936562 Loss of heterozygosity (LOH) of the hDMP1 gene was detectable in approximately 35% of human lung carcinomas, which was found in mutually exclusive fashion with LOH of INK4a/ARF or that of P53. DMP1 is a pivotal tumor suppressor for human lung cancers.
15010895 Observational study of gene-disease association. (HuGE Navigator)
12917399 hDMP1beta antagonizes hDMP1alpha activity and cellular functions of hDMP1 may be regulated by cellular hDMP1 isoform levels

AA Sequence

MSTVEEDSDTVTVETVNSVTLTQDTEGNLILHCPQNEADEIDSEDSIEPPHKRLCLSSEDDQSIDDSTPC      1 - 70
ISVVALPLSENDQSFEVTMTATTEVADDEVTEGTVTQIQILQNEQLDEISPLGNEEVSAVSQAWFTTKED     71 - 140
KDSLTNKGHKWKQGMWSKEEIDILMNNIERYLKARGIKDATEIIFEMSKDERKDFYRTIAWGLNRPLFAV    141 - 210
YRRVLRMYDDRNHVGKYTPEEIEKLKELRIKHGNDWATIGAALGRSASSVKDRCRLMKDTCNTGKWTEEE    211 - 280
EKRLAEVVHELTSTEPGDIVTQGVSWAAVAERVGTRSEKQCRSKWLNYLNWKQSGGTEWTKEDEINLILR    281 - 350
IAELDVADENDINWDLLAEGWSSVRSPQWLRSKWWTIKRQIANHKDVSFPVLIKGLKQLHENQKNNPTLL    351 - 420
ENKSGSGVPNSNTNSSVQHVQIRVARLEDNTAISSSPMAALQIPVQITHVSSADSPATVDSETITLNSGT    421 - 490
LQTFEILPSFHLQPTGTPGTYLLQTSSSQGLPLTLTASPTVTLTAAAPASPEQIIVHALSPEHLLNTSDN    491 - 560
VTVQCHTPRVIIQTVATEDITSSISQAELTVDSDIQSSDFPEPPDALEADTFPDEIHHPKMTVEPSFNDA    561 - 630
HVSKFSDQNSTELMNSVMVRTEEEISDTDLKQEESPSDLASAYVTEGLESPTIEEQVDQTIDDETILIVP    631 - 700
SPHGFIQASDVIDTESVLPLTTLTDPILQHHQEESNIIGSSLGSPVSEDSKDVEDLVNCH              701 - 760
//

Text Mined References (26)

PMID Year Title
26187004 2015 Human DMTF1? antagonizes DMTF1? regulation of the p14(ARF) tumor suppressor and promotes cellular proliferation.
25965824 2015 MicroRNA-155 promotes bladder cancer growth by repressing the tumor suppressor DMTF1.
24958102 2014 Long noncoding RNA MRUL promotes ABCB1 expression in multidrug-resistant gastric cancer cell sublines.
23938323 2013 Cooperation between Dmp1 loss and cyclin D1 overexpression in breast cancer.
23045280 2013 Prognostic value of the hDMP1-ARF-Hdm2-p53 pathway in breast cancer.
22479309 2012 Genome-wide association study to identify common variants associated with brachial circumference: a meta-analysis of 14 cohorts.
22331460 2012 Dmp1 physically interacts with p53 and positively regulates p53's stability, nuclear localization, and function.
20351715 2011 Meta-analysis of genome-wide association data of bipolar disorder and major depressive disorder.
18598225 2008 Role of DMP1 and its future in lung cancer diagnostics.
18559489 2008 Emerging roles of DMP1 in lung cancer.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17972942 2008 The hDMP1 tumor suppressor is a new WT1 target in myeloid leukemias.
17936562 2007 Mutually exclusive inactivation of DMP1 and ARF/p53 in lung cancer.
17237816 2007 Dmp1 and tumor suppression.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15010895 2004 Single nucleotide polymorphisms in breast cancer.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12917399 2003 Alternative splicing of the human cyclin D-binding Myb-like protein (hDMP1) yields a truncated protein isoform that alters macrophage differentiation patterns.
12853948 2003 The DNA sequence of human chromosome 7.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10095122 1999 Cloning and chromosomal localization of the gene encoding human cyclin D-binding Myb-like protein (hDMP1).
9847074 1998 Toward a complete human genome sequence.
9110174 1997 Large-scale concatenation cDNA sequencing.
8619474 1996 A "double adaptor" method for improved shotgun library construction.