Property Summary

NCBI Gene PubMed Count 5
PubMed Score 14.47
PubTator Score 1.86

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
non-small cell lung cancer 2890 3.8e-10
adult high grade glioma 3801 2.2e-02
Disease Target Count Z-score Confidence
Lissencephaly 69 4.059 2.0
Microcephaly 166 3.435 1.7

Expression

  Differential Expression (2)

Disease log2 FC p
adult high grade glioma 1.100 2.2e-02
non-small cell lung cancer 1.035 3.8e-10

Gene RIF (2)

AA Sequence

MELRSELPSVPGAATAAAATATGPPVASVASVAAAAAAAASLPVSVAGGLLRGPPLLLRAAEKYPRTPKC      1 - 70
ARCRNHGVVSALKGHKRYCRWKDCLCAKCTLIAERQRVMAAQVALRRQQAQEENEARELQLLYGTAEGLA     71 - 140
LAAANGIIPPRPAYEVFGSVCAADGGGPGAGAPAGTGGGAAGAGGSEAKLQKFDLFPKTLLQAGRPGSPL    141 - 210
PPPVKPLSPDGADSGPGTSSPEVRPGSGSENGDGESFSGSPLARASKEAGGSCPGSAGPGGGGEEDSPGS    211 - 280
ASPLGSESGSEADKEEGEAAPAPGLGGGSGPRQRTPLDILTRVFPGHRRGVLELVLQGCGGDVVQAIEQV    281 - 350
LNHHRGGLAAGLGPAAPPDKAAVGAAAAADDAWPSRVDAAAAAAAAAGGPGLPAPLQAGPAAPPHHRPLL    351 - 420
AGAMAPGALGSLSSRSAFSPLQPNASHFGADAGAYPLGAPLGLSPLRLAYSAAAAHSRGLAFMAPYSTAG    421 - 490
LVPTLGFRPPMDYAFSDLMRDRSAAAAAAVHKEPTYGGGLYGPMVNGAPEKQ                      491 - 542
//

Text Mined References (6)

PMID Year Title