Property Summary

NCBI Gene PubMed Count 61
PubMed Score 39.57
PubTator Score 181.32

Knowledge Summary

Patent

No data available

Expression

Gene RIF (49)

PMID Text
26802432 This review will focus on the aberrant splicing of tumor suppressor/oncogenes that belong to the DMP1-ARF-MDM2-p53 pathway
25678029 DMP-1 immunostaining was higher for MTA and PC, confirming the reparative and bioinductive capacity of these materials.
25630512 The findings indicate that DMP-1 is a useful marker of osteogenic differentiation and mineralisation in soft tissue tumours
25578972 Expressions of dentin matrix protein (DMP)-1 and osteopontin (OPN) were observed in both normal dentin and dentin from DGI-I affected patients, without significant differences
25537728 identify alternative splicing as a mechanism utilized by cancer cells to modulate the DMP1 locus through diminishing DMP1alpha tumour suppressor expression
25180662 A family of autosomal recessive form of Hypophosphatemic rickets secondary to a DMP1 mutation located in the first coding exon of the gene, is reported.
25026495 Results suggest that FAM20C suppresses FGF23 production by enhancing DMP1 expression, and inactivating mutations in FAM20C cause FGF23-related hypophosphatemia by decreasing transcription of DMP1.
24987156 DMP1 may play an important role in maintaining the chondrogenic phenotype and its possible involvement in altered cartilage matrix remodelling and degradation in disease conditions like osteoarthritis.
24441185 DMP1 and DSPP were more abundant in carious than in sound samples.
23559304 DMP-1 is a matrix marker expressed around osteocytes in human woven and lamellar bone and is useful in identifying osteosarcoma and other bone-forming tumours.
22695891 Mutations in PHEX and DMP1 play a role in causing hypophosphatemic rickets.
22552299 DMP1 is regulated post-transcriptionally by let-7 during odontoblast differentiation.
22152625 DMP-1 stimulated production of IL-6/IL-8 from pulp fibroblasts. Inhibition of p38 mitogen-activated protein kinase pathway blocked proinflammatory effect on pulp fibroblasts. DMP-1 might participate in development of inflammatory changes in pulp.
22093791 Simvastatin plus all-trans retinoic acid reduces expression of WT1 and DMP1 in the promyelocytic leukemia cell line NB4.
21642437 DMP1 is specifically involved in signaling via extracellular matrix-cell surface interaction.
21299946 possible role of dentine matrix protein 1 in the aetiology of [aggressive periodontitis]
21190990 after VE-cadherin induction by DMP1, DMP1 inhibited VEGFR-2 phosphorylation and Src-mediated signaling; DMP1 is identified as a new specific inhibitor of VEGF-induced angiogenesis
21062982 Study shows the pivotal roles of Dmp1 in HER2/neu-p53 signaling and breast carcinogenesis.
21050253 Data show the wide spectrum of genetic variation that can be seen in PHEX, FGF23 and DMP1 when screening a large cohort with hypophosphatemic rickets.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20499351 clinical and laboratory observations in this family confirm that DMP1 has an important role in normal skeletal development and mineral homeostasis
20213538 study describes a Japanese family that includes 2 autosomal recessive hypophosphatemic rickets-affected siblings carrying a novel mutation of the DMP1 gene (98G>A, W33X), which leads to a truncated DMP protein with no putative biological function
20201926 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19796717 The identified genetic mutation underscores the importance of DMP-1 mutations in the pathogenesis of autosomal recessive form of hypophosphatemia.
19679205 The patterns of expression of FGF-23, MEPE, and DMP1 differ markedly in trabecular bone, suggesting that individual osteocytes may have specialized functions.
19453261 Observational study of gene-disease association. (HuGE Navigator)
19007919 A novel DMP1 deletion is identified as the cause of autosomal recessive hypophosphatemic rickets, as well as demonstrated that the ARHR mutations alter DMP1 cellular processing, and that DMP1 can be regulated by vitamin D.
18819913 Dentin matrix protein-1 isoforms promote differential cell attachment and migration
18757373 binding of DMP1 with GRP-78 receptor might be an important mechanism by which DMP1 is internalized and transported to the nucleus during bone and tooth development
18660670 inactivating mutations in DMP1 increase, through yet unknown mechanisms, FGF23 synthesis and thus enhance renal phosphate excretion--REVIEW
18214537 mRNA of DMP1 involved in the pathogenesis of hypophosphataemic rickets is highly expressed in cells of the osteoblasts/osteocyte lineage.
18037646 Discussion of DMP1 role in the maturation of odontoblasts and osteoblasts as well as in mineralization; identification of DMP1 mutations in autosomal-recessive hypophosphatemic rickets; and regulation of phosphate homeostasis through FGF23 [review].
17434448 Thus, our results suggest that Cbfalpha1 upregulates DMP1 gene expression differentially that may contribute to the spatial-temporal expression pattern of DMP1 during odontoblast differentiation.
17136477 DMP1 has a role in breast cancer progression and bone metastases development
17033625 DMP1 may regulate FGF23 expression.
17033621 Absence of DMP1 results in defective osteocyte maturation and increased FGF23 expression, leading to pathological changes in bone mineralization.
16679514 DMP1 regulates the expression of the DSPP gene
16421105 analysis of a chondroitin sulfate chain attached to the bone dentin matrix protein 1 NH2-terminal fragment
16357164 Dentin matrix protein 1 enhances invasion potential of colon cancer cells by bridging matrix metalloproteinase-9 to integrins and CD44
16294270 Deletion of mouse Dmp1 results in bone hypomineralization.
15954904 DMP1 is expressed in parietal cells of Bowman's capsule and throughout the ductal system of nephrons.
15728181 8-kb region of the Dentin matrix protein 1 (DMP1) gene is a target for mechanotransduction in osteocytes, and its cis-regulatory activity may be correlated to local strain in bone
15329369 DMP1 is expressed in salivary gland ducts.
15108359 a silencing cis-element may play a critical role in the regulation of DMP1 cell-specific expression
15001995 Findings indicate that DMP1 immunohistochemistry is a useful tool for identifying phosphaturic mesenchymal tumors (PMTs).
14578349 dentin matrix protein-1 is processed by Bone morphogenetic protein-1/Tolloid-like proteinases
12929940 DMP1 immunostaining intensity and extent scores were significantly higher in adenocarcinoma (p = 0.0004) and squamous carcinoma (p < 0.0001) samples compared with adjacent normal lung tissue
11825898 Three SIBLINGs (small integrin-binding ligand, N-linked glycoproteins) enhance factor H's cofactor activity enabling MCP-like cellular evasion of complement-mediated attack.

AA Sequence

MKISILLMFLWGLSCALPVTRYQNNESEDSEEWKGHLAQAPTPPLESSESSEGSKVSSEEQANEDPSDST      1 - 70
QSEEGLGSDDHQYIYRLAGGFSRSTGKGGDDKDDDEDDSGDDTFGDDDSGPGPKDRQEGGNSRLGSDEDS     71 - 140
DDTIQASEESAPQGQDSAQDTTSESRELDNEDRVDSKPEGGDSTQESESEEHWVGGGSDGESSHGDGSEL    141 - 210
DDEGMQSDDPESIRSERGNSRMNSAGMKSKESGENSEQANTQDSGGSQLLEHPSRKIFRKSRISEEDDRS    211 - 280
ELDDNNTMEEVKSDSTENSNSRDTGLSQPRRDSKGDSQEDSKENLSQEESQNVDGPSSESSQEANLSSQE    281 - 350
NSSESQEEVVSESRGDNPDPTTSYVEDQEDSDSSEEDSSHTLSHSKSESREEQADSESSESLNFSEESPE    351 - 420
SPEDENSSSQEGLQSHSSSAESQSEESHSEEDDSDSQDSSRSKEDSNSTESKSSSEEDGQLKNIEIESRK    421 - 490
LTVDAYHNKPIGDQDDNDCQDGY                                                   491 - 513
//

Text Mined References (63)

PMID Year Title
26802432 2016 Aberrant splicing of the DMP1-ARF-MDM2-p53 pathway in cancer.
25678029 2016 Immunolocalization of dentin matrix protein-1 in human primary teeth treated with different pulp capping materials.
25630512 2015 Dentine matrix protein 1 (DMP-1) is a marker of bone formation and mineralisation in soft tissue tumours.
25578972 2014 Immunocytochemical detection of dentin matrix proteins in primary teeth from patients with dentinogenesis imperfecta associated with osteogenesis imperfecta.
25537728 2015 DMP1?, a splice isoform of the tumour suppressor DMP1 locus, induces proliferation and progression of breast cancer.
25180662 2014 Exome sequencing reveals a mutation in DMP1 in a family with familial sclerosing bone dysplasia.
25026495 2014 Functional analysis of mutant FAM20C in Raine syndrome with FGF23-related hypophosphatemia.
24987156 2014 Role of dentin matrix protein 1 in cartilage redifferentiation and osteoarthritis.
24441185 2013 Dentin matrix protein 1 and dentin sialophosphoprotein in human sound and carious teeth: an immunohistochemical and colorimetric assay.
23559304 2013 Dentine matrix protein 1 (DMP-1) is a marker of bone-forming tumours.
23064961 2013 GWAS of dental caries patterns in the permanent dentition.
22695891 2012 Mutational analysis of PHEX, FGF23, DMP1, SLC34A3 and CLCN5 in patients with hypophosphatemic rickets.
22582013 2012 Secreted kinase phosphorylates extracellular proteins that regulate biomineralization.
22552299 2012 DMP1 is a target of let-7 in dental pulp cells.
22152625 2012 Dentin matrix protein-1 activates dental pulp fibroblasts.
22093791 2011 [Effects of simvastatin plus all-trans retinoic acid on WT1/hDMP1 gene expression profiles of human promyelocytic leukemia cell line NB4].
21642437 2011 Dentin matrix protein 1 (DMP1) signals via cell surface integrin.
21299946 2011 Case report: hypophosphatemic rickets and aggressive periodontitis: a review of the role of dentine matrix protein 1 in the pathogenesis.
21190990 2011 Dentin matrix protein 1 induces membrane expression of VE-cadherin on endothelial cells and inhibits VEGF-induced angiogenesis by blocking VEGFR-2 phosphorylation.
21062982 2010 Critical roles of DMP1 in human epidermal growth factor receptor 2/neu-Arf-p53 signaling and breast cancer development.
21050253 2011 Mutational analysis of PHEX, FGF23 and DMP1 in a cohort of patients with hypophosphatemic rickets.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20499351 2010 Long-term clinical outcome and carrier phenotype in autosomal recessive hypophosphatemia caused by a novel DMP1 mutation.
20213538 2010 A novel nonsense mutation in the DMP1 gene in a Japanese family with autosomal recessive hypophosphatemic rickets.
20201926 2010 Human variation in alcohol response is influenced by variation in neuronal signaling genes.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19796717 2010 Identification of a novel dentin matrix protein-1 (DMP-1) mutation and dental anomalies in a kindred with autosomal recessive hypophosphatemia.
19679205 2009 Patterns of FGF-23, DMP1, and MEPE expression in patients with chronic kidney disease.
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
19007919 2009 Molecular analysis of DMP1 mutants causing autosomal recessive hypophosphatemic rickets.
18819913 2008 Dentin matrix protein-1 isoforms promote differential cell attachment and migration.
18757373 2008 Endoplasmic reticulum chaperone protein GRP-78 mediates endocytosis of dentin matrix protein 1.
18660670 2008 PHEX, FGF23, DMP1 and beyond.
18214537 2008 What's new in hypophosphataemic rickets?
18037646 2007 Dentin matrix protein 1 (DMP1): new and important roles for biomineralization and phosphate homeostasis.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17936562 2007 Mutually exclusive inactivation of DMP1 and ARF/p53 in lung cancer.
17434448 2007 Upregulation of dentin matrix protein 1 promoter activities by core binding factor alpha1 in human dental pulp stem cells.
17136477 2007 Low dentin matrix protein 1 expression correlates with skeletal metastases development in breast cancer patients and enhances cell migratory capacity in vitro.
17033625 2006 DMP1 mutations in autosomal recessive hypophosphatemia implicate a bone matrix protein in the regulation of phosphate homeostasis.
17033621 2006 Loss of DMP1 causes rickets and osteomalacia and identifies a role for osteocytes in mineral metabolism.
16679514 2006 Dentin matrix protein 1 regulates dentin sialophosphoprotein gene transcription during early odontoblast differentiation.
16421105 2006 A chondroitin sulfate chain attached to the bone dentin matrix protein 1 NH2-terminal fragment.
16357164 2005 Dentin matrix protein 1 enhances invasion potential of colon cancer cells by bridging matrix metalloproteinase-9 to integrins and CD44.
16294270 2005 DMP1 depletion decreases bone mineralization in vivo: an FTIR imaging analysis.
15954904 2005 Renal expression of SIBLING proteins and their partner matrix metalloproteinases (MMPs).
15728181 2005 Dentin matrix protein 1 gene cis-regulation: use in osteocytes to characterize local responses to mechanical loading in vitro and in vivo.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15329369 2004 Expression of SIBLINGs and their partner MMPs in salivary glands.
15108359 2004 Binding of two nuclear factors to a novel silencer element in human dentin matrix protein 1 (DMP1) promoter regulates the cell type-specific DMP1 gene expression.
15001995 2004 Expression of dentin matrix protein 1 in tumors causing oncogenic osteomalacia.
14578349 2004 Bone morphogenetic protein-1/Tolloid-like proteinases process dentin matrix protein-1.
12929940 2003 Dentin matrix protein 1 is expressed in human lung cancer.
12615915 2003 Dual functional roles of dentin matrix protein 1. Implications in biomineralization and gene transcription by activation of intracellular Ca2+ store.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11856645 2002 Investigation of osteocalcin, osteonectin, and dentin sialophosphoprotein in developing human teeth.
11825898 2002 Three SIBLINGs (small integrin-binding ligand, N-linked glycoproteins) enhance factor H's cofactor activity enabling MCP-like cellular evasion of complement-mediated attack.
10775676 2000 Promotion of selective cell attachment by the RGD sequence in dentine matrix protein 1.
10757113 1999 Recombinant expression and characterization of dentin matrix protein 1.
9177774 1997 Elucidation of the sequence and the genomic organization of the human dentin matrix acidic phosphoprotein 1 (DMP1) gene: exclusion of the locus from a causative role in the pathogenesis of dentinogenesis imperfecta type II.
8889549 1996 Generation and analysis of 280,000 human expressed sequence tags.
8586437 1995 Mapping of the human dentin matrix acidic phosphoprotein gene (DMP1) to the dentinogenesis imperfecta type II critical region at chromosome 4q21.
8509401 1993 Characterization of a novel dentin matrix acidic phosphoprotein. Implications for induction of biomineralization.