Property Summary

NCBI Gene PubMed Count 22
PubMed Score 22.99
PubTator Score 12.51

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
breast carcinoma 1614 1.9e-04
fibroadenoma 557 4.3e-02
Disease Target Count
DMGDH deficiency 1

Expression

  Differential Expression (2)

Disease log2 FC p
breast carcinoma -1.100 1.9e-04
fibroadenoma -1.200 4.3e-02

Protein-protein Interaction (1)

Gene RIF (9)

PMID Text
26675765 In agreement with previous studies, we show that the genetic variant rs921943 in DMGDH is significantly associated with selenium status in United Kingdom pregnant women.
25795213 Genetic variation of DMGDH was associated with higher plasma insulin, increased insulin resistance and increased risk of incident diabetes.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20662904 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20634891 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19048631 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18937046 analysis of dimethylglycine dehydrogenase deficiency associated with pathogenic variant H109R

AA Sequence

MLRPGAQLLRGLLLRSCPLQGSPGRPRSVCGREGEEKPPLSAETQWKDRAETVIIGGGCVGVSLAYHLAK      1 - 70
AGMKDVVLLEKSELTAGSTWHAAGLTTYFHPGINLKKIHYDSIKLYEKLEEETGQVVGFHQPGSIRLATT     71 - 140
PVRVDEFKYQMTRTGWHATEQYLIEPEKIQEMFPLLNMNKVLAGLYNPGDGHIDPYSLTMALAAGARKCG    141 - 210
ALLKYPAPVTSLKARSDGTWDVETPQGSMRANRIVNAAGFWAREVGKMIGLEHPLIPVQHQYVVTSTISE    211 - 280
VKALKRELPVLRDLEGSYYLRQERDGLLFGPYESQEKMKVQDSWVTNGVPPGFGKELFESDLDRIMEHIK    281 - 350
AAMEMVPVLKKADIINVVNGPITYSPDILPMVGPHQGVRNYWVAIGFGYGIIHAGGVGKYLSDWILHGEP    351 - 420
PFDLIELDPNRYGKWTTTQYTEAKARESYGFNNIVGYPKEERFAGRPTQRVSGLYQRLESKCSMGFHAGW    421 - 490
EQPHWFYKPGQDTQYRPSFRRTNWFEPVGSEYKQVMQRVAVTDLSPFGKFNIKGQDSIRLLDHLFANVIP    491 - 560
KVGFTNISHMLTPKGRVYAELTVSHQSPGEFLLITGSGSELHDLRWIEEEAVKGGYDVEIKNITDELGVL    561 - 630
GVAGPQARKVLQKLTSEDLSDDVFKFLQTKSLKVSNIPVTAIRISYTGELGWELYHRREDSVALYDAIMN    631 - 700
AGQEEGIDNFGTYAMNALRLEKAFRAWGLEMNCDTNPLEAGLEYFVKLNKPADFIGKQALKQIKAKGLKR    701 - 770
RLVCLTLATDDVDPEGNESIWYNGKVVGNTTSGSYSYSIQKSLAFAYVPVQLSEVGQQVEVELLGKNYPA    771 - 840
VIIQEPLVLTEPTRNRLQKKGGKDKT                                                841 - 866
//

Text Mined References (24)

PMID Year Title
26675765 2016 Genetic polymorphisms that affect selenium status and response to selenium supplementation in United Kingdom pregnant women.
25795213 2015 Dimethylglycine Deficiency and the Development of Diabetes.
25343990 2015 Genome-wide association study of selenium concentrations.
24816252 2014 An atlas of genetic influences on human blood metabolites.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23720494 2013 Genome-wide association study identifies loci affecting blood copper, selenium and zinc.
23378610 2013 Genetic variants associated with glycine metabolism and their role in insulin sensitivity and type 2 diabetes.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20662904 2010 Polymorphisms located in the region containing BHMT and BHMT2 genes as maternal protective factors for orofacial clefts.
20634891 2010 Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19048631 2009 Oral facial clefts and gene polymorphisms in metabolism of folate/one-carbon and vitamin A: a pathway-wide association study.
18937046 2008 Molecular basis of dimethylglycine dehydrogenase deficiency associated with pathogenic variant H109R.
18614015 2008 A mitochondrial protein compendium elucidates complex I disease biology.
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12107410 2002 Expressed sequence tag analysis of human RPE/choroid for the NEIBank Project: over 6000 non-redundant transcripts, novel genes and splice variants.
11231903 2001 Cloning of dimethylglycine dehydrogenase and a new human inborn error of metabolism, dimethylglycine dehydrogenase deficiency.
10767172 2000 Structure and analysis of the human dimethylglycine dehydrogenase gene.
10102904 1999 Defect in dimethylglycine dehydrogenase, a new inborn error of metabolism: NMR spectroscopy study.