Property Summary

NCBI Gene PubMed Count 40
PubMed Score 17.14
PubTator Score 70.38

Knowledge Summary

Patent

No data available

Expression

Protein-protein Interaction (12)

Gene RIF (28)

PMID Text
26976601 BRCA2 protein stimulates DMC1-mediated DNA strand exchange between RPA-ssDNA complexes and duplex DNA, thus identifying BRCA2 as a mediator of DMC1 recombination function.
26709229 Dmc1 can reject divergent DNA sequences while bypassing a few mismatches in the DNA sequence.
26088134 In contrast to RAD51, stabilization of the presynaptic filament via ATP hydrolysis attenuation is insufficient for enhancement of the DMC1-catalyzed recombination reaction.
23545642 truncated DMC1 octamers further stack with alternate polarity into a filament
23265958 results suggested mutations in the coding sequence of DMC1 are not associated with premature ovarian failure in Chinese women
23182424 conserved lysine in the Walker A motif of hDMC1 is critical for ATP binding.
22156371 The results suggested that PSF may function as an activator for the meiosis-specific recombinase DMC1.
21903585 RAD51-associated protein 1 (RAD51AP1) interacts with the meiotic recombinase DMC1 through a conserved motif.
21307306 RAD51AP1 foci colocalize with a subset of DMC1 foci in spermatocytes.
21151113 D-loops in a human DMC1-driven reaction are substantially more resistant to dissociation by branch-migration proteins such as RAD54 than those formed by RAD51.
20600108 the Dmc1 filament formed on single-stranded DNA has a mass per unit length expected from approximately 6.5 subunits per turn
20378615 Observational study of gene-disease association. (HuGE Navigator)
19714462 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19460752 Knockdown of DMC1 dosage suppressor of mck1 homolog, meiosis-specific homologous recombination (DMC1) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells
19076215 DMC1-I37N polymorphism may be a source of improper meiotic recombination, causing meiotic defects in humans
19004837 Reversibility, equilibration, and fidelity of strand exchange reaction between short oligonucleotides promoted by RecA protein from escherichia coli and human Rad51 and Dmc1 proteins.
18566005 Biochemical analyses revealed that the human DMC1-M200V variant had reduced stability, and was moderately defective in catalyzing in vitro recombination reactions.
18535008 Results indicate that Rad51 and Dmc1 filaments are essentially identical with respect to several structural parameters, including persistence length, helical pitch, filament diameter, DNA base pairs per helical turn and helical handedness.
18355319 The interaction of DMC1 and the homologue of the large subunit of CAF-1 is reported.
18166824 Data show that DMC1 mutations may be one explanation for premature ovarian failure.
18166824 Observational study of gene-disease association. (HuGE Navigator)
17639081 Hop2/Mnd1 greatly stimulates Dmc1 to promote synaptic complex formation on long duplex DNAs
17541404 BRCA2 binds the meiosis-specific recombinase DMC1 and define the primary DMC1 interaction site to a 26 amino-acid region
15917244 activation of hDmc1 is mediated through conformational changes induced by free Ca2+ ion binding to a protein site that is distinct from the Mg2+.ATP-binding center
15917243 N-terminal domain of DMC1 is required for the formation of the octamer, which may support the proper DNA binding activity of the DMC1 protein.
15164066 hDmc1-mediated DNA recombination initiates through the nucleation of hDmc1 onto ssDNA to form a helical nucleoprotein filament
15125839 The monomeric structure of the Dmc1 protein closely resembled those of the human and archaeal Rad51 proteins. We found another hydrogen bonding interaction at the polymer interface.
14764457 p53 might be involved in homologous recombination and/or checkpoint function by directly binding to DMC1 protein to repress genomic instability in meiotic germ cells

AA Sequence

MKEDQVVAEEPGFQDEEESLFQDIDLLQKHGINVADIKKLKSVGICTIKGIQMTTRRALCNVKGLSEAKV      1 - 70
DKIKEAANKLIEPGFLTAFEYSEKRKMVFHITTGSQEFDKLLGGGIESMAITEAFGEFRTGKTQLSHTLC     71 - 140
VTAQLPGAGGYPGGKIIFIDTENTFRPDRLRDIADRFNVDHDAVLDNVLYARAYTSEHQMELLDYVAAKF    141 - 210
HEEAGIFKLLIIDSIMALFRVDFSGRGELAERQQKLAQMLSRLQKISEEYNVAVFVTNQMTADPGATMTF    211 - 280
QADPKKPIGGHILAHASTTRISLRKGRGELRIAKIYDSPEMPENEATFAITAGGIGDAKE              281 - 340
//

Text Mined References (41)

PMID Year Title
26976601 2016 BRCA2 regulates DMC1-mediated recombination through the BRC repeats.
26709229 2016 Tolerance of DNA Mismatches in Dmc1 Recombinase-mediated DNA Strand Exchange.
26088134 2015 Functional Relationship of ATP Hydrolysis, Presynaptic Filament Stability, and Homologous DNA Pairing Activity of the Human Meiotic Recombinase DMC1.
25416956 2014 A proteome-scale map of the human interactome network.
23545642 2013 Structure of a filament of stacked octamers of human DMC1 recombinase.
23265958 2013 Mutations in DMC1 are not responsible for premature ovarian failure in Chinese women.
23182424 2013 Role of the conserved lysine within the Walker A motif of human DMC1.
22899867 2012 Analysis of meiosis regulators in human gonads: a sexually dimorphic spatio-temporal expression pattern suggests involvement of DMRT1 in meiotic entry.
22156371 2012 Human PSF concentrates DNA and stimulates duplex capture in DMC1-mediated homologous pairing.
21903585 2011 RAD51-associated protein 1 (RAD51AP1) interacts with the meiotic recombinase DMC1 through a conserved motif.
21307306 2011 Molecular basis for enhancement of the meiotic DMC1 recombinase by RAD51 associated protein 1 (RAD51AP1).
21151113 2011 The resistance of DMC1 D-loops to dissociation may account for the DMC1 requirement in meiosis.
20729832 2010 Purified human BRCA2 stimulates RAD51-mediated recombination.
20600108 2010 Helical filaments of human Dmc1 protein on single-stranded DNA: a cautionary tale.
20378615 2010 Evaluation of 172 candidate polymorphisms for association with oligozoospermia or azoospermia in a large cohort of men of European descent.
19714462 2010 Genetic variation in genes interacting with BRCA1/2 and risk of breast cancer in the Cypriot population.
19076215 2009 Biochemical analysis of the human DMC1-I37N polymorphism.
19004837 2009 Reversibility, equilibration, and fidelity of strand exchange reaction between short oligonucleotides promoted by RecA protein from escherichia coli and human Rad51 and Dmc1 proteins.
18566005 2008 Structural and functional analyses of the DMC1-M200V polymorphism found in the human population.
18535008 2008 A comparative analysis of Dmc1 and Rad51 nucleoprotein filaments.
18355319 2008 Interaction between Lim15/Dmc1 and the homologue of the large subunit of CAF-1: a molecular link between recombination and chromatin assembly during meiosis.
18166824 2008 Genetic investigation of four meiotic genes in women with premature ovarian failure.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17639081 2007 Hop2/Mnd1 acts on two critical steps in Dmc1-promoted homologous pairing.
17541404 2007 Interactions between human BRCA2 protein and the meiosis-specific recombinase DMC1.
16341674 2005 Transcriptome analysis of human gastric cancer.
15917244 2005 Activation of human meiosis-specific recombinase Dmc1 by Ca2+.
15917243 2005 Role of the N-terminal domain of the human DMC1 protein in octamer formation and DNA binding.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15461802 2004 A genome annotation-driven approach to cloning the human ORFeome.
15164066 2004 Human meiotic recombinase Dmc1 promotes ATP-dependent homologous DNA strand exchange.
15125839 2004 Structural basis for octameric ring formation and DNA interaction of the human homologous-pairing protein Dmc1.
14764457 2004 p53 Protein interacts specifically with the meiosis-specific mammalian RecA-like protein DMC1 in meiosis.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10737800 2000 Shotgun sequencing of the human transcriptome with ORF expressed sequence tags.
10591208 1999 The DNA sequence of human chromosome 22.
10562567 1999 The meiosis-specific recombinase hDmc1 forms ring structures and interacts with hRad51.
9826763 1998 Interaction of human rad51 recombination protein with single-stranded DNA binding protein, RPA.
8602360 1996 The mouse and human homologs of DMC1, the yeast meiosis-specific homologous recombination gene, have a common unique form of exon-skipped transcript in meiosis.
8590282 1995 Expression profiles of a human gene identified as a structural homologue of meiosis-specific recA-like genes.