Property Summary

NCBI Gene PubMed Count 45
PubMed Score 140.77
PubTator Score 65.85

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
non-small cell lung cancer 2.052 2.8e-11
lung cancer 3.400 2.0e-06

Gene RIF (29)

PMID Text
26829219 These data indicate that certain missense mutations diminish the ability of the Dlx5 homeodomain to recognize and bind target DNAs, and they likely destabilize the formation of functional complexes.
25332435 Absent expression of the osteoblast-specific maternally imprinted genes, DLX5 and DLX6, causes split hand/split foot malformation type I.
25196357 Heterozygous DLX5 nonsense mutation c.G115T(p.E39X) associated with isolated split-hand/foot malformation with reduced penetrance and variable expressivity in two unrelated Polish families.
25025858 In cells grown on titanium support, DLX5 and RUNX1 were respectively upregulated (+3.12-fold) and downregulated (-2.14-fold)
24496061 A novel heterozygous mutation in exon 3 of DLX5 found in the family members with SHFM1 phenotype.
24459211 Genome sequencing of the deletion breakpoints showed that the DLX5 and DLX6 genes are disomic but the putative DYNC1I1 exon 15 and 17 enhancers are deleted.
23193016 The strongest evidence for altered methylation patterns in shiftworkers was observed for DLX5 gene.
23169702 The duplicated region harbors only DLX5 and DLX6, which are known for their role in SHFM1.
22342398 Two patients that have in common a p63-Dlx5/Dlx6 pathway dysregulation.
22332551 Cyclic tensile stress may induce differentiation of periodontal ligament stem cells towards mineralized tissue cells by promoting Dlx5 mRNA expression and decreasing Msx2 expression.
22121204 the first intragenic DLX5 mutation in split hand and foot malformation is found; a potential dual role for DLX5 in limb development is suggested
21205918 DLX5 is significantly increased in heart tissue from calcific aortic valve patients compared to controls.
21108812 MDA-MB-231 breast neoplasms did not express DLX5 but the resulting bone/lung metastases did.
21045156 Data suggest that DLX5 plays a significant role in the pathogenesis of some ovarian cancers by enhancing IRS-2-AKT signaling.
20808887 p63 binds to an enhancer element in the SHFM1 locus and this element controls expression of DLX6 and DLX5 which are important for limb development.
20634891 Observational study of gene-disease association. (HuGE Navigator)
19497851 The MYC promoter is specifically activated by overexpression of DLX5.
19453261 Observational study of gene-disease association. (HuGE Navigator)
19195802 Results describe the expression of DLX5 and DLX6 in autistic spectrum disorder patients in an attempt to identify potential abnormality of expression.
18413826 Activation of placenta-specific transcription factor distal-less homeobox 5 predicts clinical outcome in primary lung cancer patients.
18316591 Dlx5 can act as an oncogene by cooperating with Akt2 to promote lymphomagenesis
17701895 DLX5 and DLX6 are not imprinted in humans and are not likely to be direct targets of MeCP2 modulation.
17363207 high expression of mutated MECP2 in TRD mutation showed bialleic expression of DLX5 suggesting loss of imprinting
16467978 In dental follicle cells, gene expression of runx2, DLX-5, and MSX-2 was unaffected during osteogenic differentiation in vitro.
15954098 DLX5 is a target for MeCP2, linking genomic imprinting and Rett syndrome [review]
12782124 DLX5 was confirmed to be imprinted in normal human lymphoblasts and brain tissues by a polymorphic analysis
11959851 A RING finger protein Praja1 regulates Dlx5-dependent transcription through its ubiquitin ligase activity for the Dlx/Msx-interacting MAGE/Necdin family protein, Dlxin-1.
11084035 Dlxin-1 binds Dlx5 and several additional homeodomain proteins and may regulate the function of Dlx family members in bone formation
9111364 In mice, biological and biochemical observations suggest that functional antagonism through heterodimer formation is a mechanism for regulating the transcriptional actions of Msx and Dlx homeoproteins.

AA Sequence

MTGVFDRRVPSIRSGDFQAPFQTSAAMHHPSQESPTLPESSATDSDYYSPTGGAPHGYCSPTSASYGKAL      1 - 70
NPYQYQYHGVNGSAGSYPAKAYADYSYASSYHQYGGAYNRVPSATNQPEKEVTEPEVRMVNGKPKKVRKP     71 - 140
RTIYSSFQLAALQRRFQKTQYLALPERAELAASLGLTQTQVKIWFQNKRSKIKKIMKNGEMPPEHSPSSS    141 - 210
DPMACNSPQSPAVWEPQGSSRSLSHHPHAHPPTSNQSPASSYLENSASWYTSAASSINSHLPPPGSLQHP    211 - 280
LALASGTLY                                                                 281 - 289
//

Text Mined References (45)

PMID Year Title
26829219 2016 Dlx5 Homeodomain:DNA Complex: Structure, Binding and Effect of Mutations Related to Split Hand and Foot Malformation Syndrome.
25332435 2014 Absent expression of the osteoblast-specific maternally imprinted genes, DLX5 and DLX6, causes split hand/split foot malformation type I.
25196357 2014 Heterozygous DLX5 nonsense mutation associated with isolated split-hand/foot malformation with reduced penetrance and variable expressivity in two unrelated families.
25025858 2014 Expression of SP7, RUNX1, DLX5, and CTNNB1 in human mesenchymal stem cells cultured on xenogeneic bone substitute as compared with machined titanium.
24496061 2014 Exome sequencing reveals a heterozygous DLX5 mutation in a Chinese family with autosomal-dominant split-hand/foot malformation.
24459211 2014 Next generation sequencing of chromosomal rearrangements in patients with split-hand/split-foot malformation provides evidence for DYNC1I1 exonic enhancers of DLX5/6 expression in humans.
23193016 2013 Methylation alterations at imprinted genes detected among long-term shiftworkers.
23169702 2012 A 0.7?Mb de novo duplication at 7q21.3 including the genes DLX5 and DLX6 in a patient with split-hand/split-foot malformation.
22342398 2012 Rapp-Hodgkin syndrome and SHFM1 patients: delineating the p63-Dlx5/Dlx6 pathway.
22332551 2011 [Changes in the expression of Dlx5, Msx2, and Dlx5/Msx2 in hPDLSCs loaded with cyclic tensile stress].
22121204 2012 Identification of a novel DLX5 mutation in a family with autosomal recessive split hand and foot malformation.
21205918 2011 Tumor necrosis factor-? accelerates the calcification of human aortic valve interstitial cells obtained from patients with calcific aortic valve stenosis via the BMP2-Dlx5 pathway.
21108812 2010 Mutually exclusive expression of DLX2 and DLX5/6 is associated with the metastatic potential of the human breast cancer cell line MDA-MB-231.
21045156 2010 Upregulation of DLX5 promotes ovarian cancer cell proliferation by enhancing IRS-2-AKT signaling.
20808887 2010 Genome-wide profiling of p63 DNA-binding sites identifies an element that regulates gene expression during limb development in the 7q21 SHFM1 locus.
20634891 2010 Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia.
19497851 2009 DLX5 (distal-less homeobox 5) promotes tumor cell proliferation by transcriptionally regulating MYC.
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
19195802 2010 Expression analysis and mutation detection of DLX5 and DLX6 in autism.
18413826 2008 Activation of placenta-specific transcription factor distal-less homeobox 5 predicts clinical outcome in primary lung cancer patients.
18316591 2008 A novel recurrent chromosomal inversion implicates the homeobox gene Dlx5 in T-cell lymphomas from Lck-Akt2 transgenic mice.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17701895 2007 DLX5 and DLX6 expression is biallelic and not modulated by MeCP2 deficiency.
17363207 2007 Imprinting status of paternally imprinted DLX5 gene in Japanese patients with Rett syndrome.
16582099 2006 The high-mobility-group domain of Sox proteins interacts with DNA-binding domains of many transcription factors.
16467978 2006 Gene expression of runx2, Osterix, c-fos, DLX-3, DLX-5, and MSX-2 in dental follicle cells during osteogenic differentiation in vitro.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15954098 2005 Association by guilt: identification of DLX5 as a target for MeCP2 provides a molecular link between genomic imprinting and Rett syndrome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12853948 2003 The DNA sequence of human chromosome 7.
12782124 2003 A new imprinted cluster on the human chromosome 7q21-q31, identified by human-mouse monochromosomal hybrids.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12145306 2002 Regulation of osteocalcin gene expression by a novel Ku antigen transcription factor complex.
11959851 2002 A RING finger protein Praja1 regulates Dlx5-dependent transcription through its ubiquitin ligase activity for the Dlx/Msx-interacting MAGE/Necdin family protein, Dlxin-1.
11675124 2001 Evidence that GRIP, a PDZ-domain protein which is expressed in the embryonic forebrain, co-activates transcription with DLX homeodomain proteins.
11168022 2001 Split hand/split foot malformation with hearing loss: first report of families linked to the SHFM1 locus in 7q21.
11084035 2001 Dlxin-1, a novel protein that binds Dlx5 and regulates its transcriptional function.
10516593 1999 DLX-1, DLX-2, and DLX-5 expression define distinct stages of basal forebrain differentiation.
10451362 1999 The RRM domain of MINT, a novel Msx2 binding protein, recognizes and regulates the rat osteocalcin promoter.
9111364 1997 Heterodimerization of Msx and Dlx homeoproteins results in functional antagonism.
8889549 1996 Generation and analysis of 280,000 human expressed sequence tags.
7987313 1994 Physical mapping of the split hand/split foot locus on chromosome 7 and implication in syndromic ectrodactyly.
7907794 1994 Cloning and characterization of two members of the vertebrate Dlx gene family.