Property Summary

NCBI Gene PubMed Count 50
PubMed Score 128.53
PubTator Score 69.16

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
medulloblastoma, large-cell 1.300 3.0e-02

Gene RIF (41)

AA Sequence

MSGSFDRKLSSILTDISSSLSCHAGSKDSPTLPESSVTDLGYYSAPQHDYYSGQPYGQTVNPYTYHHQFN      1 - 70
LNGLAGTGAYSPKSEYTYGASYRQYGAYREQPLPAQDPVSVKEEPEAEVRMVNGKPKKVRKPRTIYSSYQ     71 - 140
LAALQRRFQKAQYLALPERAELAAQLGLTQTQVKIWFQNRRSKFKKLYKNGEVPLEHSPNNSDSMACNSP    141 - 210
PSPALWDTSSHSTPAPARSQLPPPLPYSASPSYLDDPTNSWYHAQNLSGPHLQQQPPQPATLHHASPGPP    211 - 280
PNPGAVY                                                                   281 - 287
//

Text Mined References (50)

PMID Year Title