Property Summary

NCBI Gene PubMed Count 28
PubMed Score 105.47
PubTator Score 47.71

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
Waldenstrons macroglobulinemia -1.129 1.8e-03
Multiple myeloma -1.079 4.9e-05
astrocytic glioma -1.600 2.3e-03
ependymoma -1.800 4.3e-03
oligodendroglioma -1.500 2.7e-03
psoriasis -1.200 3.9e-02
medulloblastoma, large-cell 1.100 2.0e-02
lung cancer 6.800 6.4e-08
pilocytic astrocytoma -1.600 1.7e-03
invasive ductal carcinoma 1.400 1.8e-02

 GO Component (1)

Gene RIF (20)

PMID Text
26833729 DLX2 expression reduces the protein components of the TTI1/TTI2/TEL2 complex, a key complex required for the proper folding and stabilization of ATM and other members of the PIKK family kinase, leading to reduced ATM-p53 signaling and senescence bypass
26799321 DLX2 plays a crucial role in radioresistance, radiation-induced epithelial to mesenchymal transition and cancer stem cell marker expression, and the expression of DLX2 is regulated by Smad2/3 signaling in A549 and MDA-MB-231 cell lines.
25651912 Results showed that Dlx-2 is involved in TGF-beta- and Wnt-induced epithelial-mesenchymal transition, glycolytic switch, and mitochondrial repression by Snail activation.
24756434 The activation of DLX2 signaling might improve tissue regeneration mediated by MSCs of dental origin. Results provide insight into the mechanism underlying the directed differentiation of MSCs of dental origin.
23674878 Increased expression of DLX2 may correlate with the advanced stage of gastric adenocarcinoma, and it may contribute to tumor development.
23331016 overexpression of DLX2 indicated poor survival in the 83 glioblastoma multiforme patients
23312518 Dlx2 (and Dlx1) are required to generate cortical interneurons in the medial ganglionic eminence.
21917150 Dlx-2 may be involved in tumor progression via the regulation of metabolic stress-induced necrosis
21357706 These findings suggest that alterations in DLX1/2 contribute to the biological consequences of FLT3 activation.
21108812 MDA-MB-231 breast neoplasms expressed DLX2.
20634891 Observational study of gene-disease association. (HuGE Navigator)
19453261 Observational study of gene-disease association. (HuGE Navigator)
19018235 Observational study of gene-disease association. (HuGE Navigator)
18728693 The DLX1 and DLX2 genes lie head-to-head in 2q32; the findings support the presence of two functional polymorphisms, one in or near each of the DLX genes that increase susceptibility to, or cause, autism.
18728693 Observational study of gene-disease association. (HuGE Navigator)
15751970 In corroboration with paired-like homeodomain protein 2 (PITX2) protein kinase C functional studies, a newly identified carboxyl-terminal PITX2 mutation associated with Axenfeld-Rieger syndrome demonstrates reduced phosphorylation.
12957859 In mice osteoblasts, both Dlx2 and Dlx5 are coordinately induced by BMP2 as early as 30 minutes into their growth and differentiation.
9111364 In mice, biological and biochemical observations suggest that functional antagonism through heterodimer formation is a mechanism for regulating the transcriptional actions of Msx and Dlx homeoproteins.
8812481 provides the sequence of human DLX2 and compares it to the murine gene.
7590232 results in mutated mice suggest that Dlx2 controls development of branchial arches and the forebrian, suggesting a role in craniofacil evolution

AA Sequence

MTGVFDSLVADMHSTQIAASSTYHQHQQPPSGGGAGPGGNSSSSSSLHKPQESPTLPVSTATDSSYYTNQ      1 - 70
QHPAGGGGGGGSPYAHMGSYQYQASGLNNVPYSAKSSYDLGYTAAYTSYAPYGTSSSPANNEPEKEDLEP     71 - 140
EIRIVNGKPKKVRKPRTIYSSFQLAALQRRFQKTQYLALPERAELAASLGLTQTQVKIWFQNRRSKFKKM    141 - 210
WKSGEIPSEQHPGASASPPCASPPVSAPASWDFGVPQRMAGGGGPGSGGSGAGSSGSSPSSAASAFLGNY    211 - 280
PWYHQTSGSASHLQATAPLLHPTQTPQPHHHHHHHGGGGAPVSAGTIF                          281 - 328
//

Text Mined References (32)

PMID Year Title
26833729 2016 A gain-of-function senescence bypass screen identifies the homeobox transcription factor DLX2 as a regulator of ATM-p53 signaling.
26799321 2016 Smad2/3-Regulated Expression of DLX2 Is Associated with Radiation-Induced Epithelial-Mesenchymal Transition and Radioresistance of A549 and MDA-MB-231 Human Cancer Cell Lines.
25651912 2015 Dlx-2 is implicated in TGF-?- and Wnt-induced epithelial-mesenchymal, glycolytic switch, and mitochondrial repression by Snail activation.
25416956 2014 A proteome-scale map of the human interactome network.
24756434 2014 Distal-less homeobox 2 promotes the osteogenic differentiation potential of stem cells from apical papilla.
24722188 2014 Protein interaction network of alternatively spliced isoforms from brain links genetic risk factors for autism.
23674878 2013 Increased expression of DLX2 correlates with advanced stage of gastric adenocarcinoma.
23535729 2013 Large-scale genotyping identifies 41 new loci associated with breast cancer risk.
23331016 2013 Upregulation of DLX2 confers a poor prognosis in glioblastoma patients by inducing a proliferative phenotype.
23312518 2013 Dlx1&2-dependent expression of Zfhx1b (Sip1, Zeb2) regulates the fate switch between cortical and striatal interneurons.
21917150 2011 Homeobox gene Dlx-2 is implicated in metabolic stress-induced necrosis.
21357706 2011 Up-regulation of homeodomain genes, DLX1 and DLX2, by FLT3 signaling.
21108812 2010 Mutually exclusive expression of DLX2 and DLX5/6 is associated with the metastatic potential of the human breast cancer cell line MDA-MB-231.
20634891 2010 Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia.
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
19018235 2008 Polymorphisms of coding trinucleotide repeats of homeogenes in neurodevelopmental psychiatric disorders.
18728693 2009 The DLX1and DLX2 genes and susceptibility to autism spectrum disorders.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15751970 2005 Protein kinase C phosphorylation modulates N- and C-terminal regulatory activities of the PITX2 homeodomain protein.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12957859 2003 Transcriptional regulation of BMP-2 activated genes in osteoblasts using gene expression microarray analysis: role of Dlx2 and Dlx5 transcription factors.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11675124 2001 Evidence that GRIP, a PDZ-domain protein which is expressed in the embryonic forebrain, co-activates transcription with DLX homeodomain proteins.
9111364 1997 Heterodimerization of Msx and Dlx homeoproteins results in functional antagonism.
8812481 1996 Sequence, organization, and transcription of the Dlx-1 and Dlx-2 locus.
7907794 1994 Cloning and characterization of two members of the vertebrate Dlx gene family.
7901126 1993 The human brain homeogene, DLX-2: cDNA sequence and alignment with the murine homologue.
7590232 1995 Null mutation of Dlx-2 results in abnormal morphogenesis of proximal first and second branchial arch derivatives and abnormal differentiation in the forebrain.
1354641 1992 DLX2 (TES1), a homeobox gene of the Distal-less family, assigned to conserved regions on human and mouse chromosomes 2.