Property Summary

NCBI Gene PubMed Count 103
PubMed Score 240.04
PubTator Score 250.95

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma 1.545 1.6e-05

Gene RIF (88)

PMID Text
27487663 Expression of D114 in the vessels of dermal microvasculature was shown to increase from 20 weeks of gestation to 20 years.
26870802 Cyclic AMP Response Element Binding Protein Mediates Pathological Retinal Neovascularization via Modulating DLL4-NOTCH1 Signaling
26808710 Data indicate the role for altered forkhead box C2 (FoxC2)-Delta-like ligand 4 (Dll4)signaling in structural alterations of saphenous veins in patients with varicose veins.
26739060 Antagonism of the DLL4-Notch signaling pathway might provide a potential therapeutic approach for breast cancer treatment by preventing angiogenesis.
26712946 DLL4 is a unique functional molecule of human circulating dendritic cells critical for directing Th1 and Th17 differentiation
26546995 DLL4 and JAG1 may have opposing effects on tumor angiogenesis in glioblastoma.
26471266 DLL4/Notch1 and BMP9 interdependent signaling induces endothelial cell quiescence via P27KIP1/thrombospondin pathway.
26404485 Macrophage Dll4 promotes lesion development in vein grafts via macrophage activation and crosstalk between macrophages and smooth muscle cells.
26299364 Heterozygous Loss-of-Function Mutations in DLL4 Cause Adams-Oliver Syndrome.
26241546 Overexpression of DLL4 is associated with thyroid tumor invasion and metastasis.
26212082 Activation of Dll4/Notch signaling led to increased expression of ephrin-B2 and subsequent inhibition of endothelial progenitor cells activity.
26111775 DLL4 and VEGFA expression was closely related to tumour diameter, clinical stage, histological grade and lymph node metastasis.
26070613 The detection of Notch1 and Delta-like 4 expression in peripheral blood lymphocytes of renal transplant recipients can serve as a positive indicator for evaluating the diagnosis and treatment efficacy of the AR reaction.
26062426 IL-23 could promote migration of human ESCC cells by activating DLL4/Notch1 signaling pathway
25986715 The expression of DLL4 was positively correlated with CD105-labeled MVD.
25833803 Among all the Notch ligands, Delta-like4 (Dll4) is specifically involved in angiogenesis. hD4R could suppress angiogenesis in vitro as manifested by network formation assay and sprouting assay.
25355291 High DLL4 expression is associated with T acute lymphoblastic leukemia.
25348865 Dormant Dbf4 mRNA in immature GV oocytes is recruited by cytoplasmic polyadenylation during oocyte maturation and is dependent on MPF activity via its cytoplasmic polyadenylation element (CPE)
25260720 these results suggest that high expression of DLL4 is associated with axillary lymph node metastasis and a poor prognosis in breast cancer, suggesting its value as a diagnostic marker for breast cancer.
25139440 Inhibition of ADAM10/17 or knockdown of DLL4 reduced the proangiogenic effects of fibulin-3 in culture
25130545 findings suggest that ADAM10/Dll4 signaling is a major signaling pathway in ECs driving inflammatory events involved in inflammation and immune cell recruitment
25041739 Dengue virus up-regulates expression of notch ligands Dll1 and Dll4 through interferon-beta signalling pathway.
24966922 Dll4 expression is up-regulated in clear cell renal cell carcinoma patients, and predicts poor prognosis.
24949865 expression of VEGF and Dll4/Notch pathway molecules in ovarian cancer
24931473 Our data suggest that renal cell carcinoma progression is caused in part by activated DLL4/Notch signaling, interaction of endothelium and cells
24696220 High expression of DLL4 is associated with metastasis in breast cancer.
24615277 Demonstrate that the action of IFNgamma on endothelial cellss, but not other cells, is highly effective for tumour angiostasis, which involves down-regulating Dll4.
24504253 Dll4-containing exosomes increase endothelial cell motility while suppressing their proliferation.
24394305 These findings indicate a potential role for the Notch-1-Dll4 signaling pathway in foreign body-induced granulomatous reactions
24025447 Synaptojanin-2 binding protein stabilizes the Notch ligands DLL1 and DLL4 and inhibits sprouting angiogenesis.
24025398 the role of macrophages and Dll4/Notch signaling in the development of inflammation in both the cardiovascular system and metabolic organs. [review]
23950980 Aberrant DLL4 expression and HIF-1alpha/VEGF angiogenesis signaling may have a role in missed abortion.
23901223 Activation of DLL4-mediated Notch signaling promotes the expression and secretion of MMP-2 proenzyme and influences the progress of gastric cancer.
23898884 and stromal DLL4 expression was found in 48% and 22% in gastric cancer, and significantly affected postoperative clinical outcomes.
23839946 direct measurement of the binding affinity of Notch1 EGF repeats 6-15 for Dll1 and Dll4 revealed that Dll4 binds with at least an order of magnitude higher affinity than Dll1
23817492 Our data suggest that miR-30a stimulates arteriolar branching by downregulating endothelial Dll4 expression, thereby controlling endothelial tip cell behavior.
23787764 High Dll4 expression is associated with glioblastoma multiforme.
23300864 Overexpresion of DLL4 in endothelial cells inhibited cell proliferation, but did not affect cell migration, sprouting angiogenesis or cell adhesion.
23275120 These findings provide evidence that high expression of DLL4 serves as an independent predictor of poor prognosis in nasopharyngeal carcinoma patients.
23239744 Upregulation of Dll4 expression in acute myeloid leukemia cells suppressed VEGF-induced endothelial cell proliferation.
23207622 DLL4 may be an important regulator for vessel proliferation and maturation in human high-grade malignant gliomas.
23108591 expression of DLL4 is associated with reduced radio-resistance, presumably by reducing hypoxia and improving chemotherapy accessibility
23086751 miR-30b and miR-30c regulate DLL4.
22699504 Dll4 skewed macrophages toward a proinflammatory phenotype ("M1"). These results suggest that Dll4-Notch signaling plays a central role in the shared mechanism for the pathogenesis of cardiometabolic disorders.
22296176 Dll4 and Jag1 are expressed in glioblastoma vasculature.
22066479 Detection of Notch1, Notch4, and DLL4 in thyroid glands and their regulation in various pathologies suggest that this pathway may play a role in thyroid carcinogenesis and angiogenesis.
22020917 DLL4 and Jagged1 siRNA gene therapy mediated by adenovirus may be useful for inhibiting growth and invasion of SGC7901 through a Notch/VEGF pathway.
22010178 In DLL4-expressing CR carcinoma xngrft model, Notch blockade combined with ionizing radiation caused tumor growth delay. The DLL4 monoclnl antibody in combination with ionizing radiation also delayed tumor growth in the non-DLL4-expressing xngrft model
21832157 we show that Tis11b silencing in endothelial cells leads to up-regulation of Dll4 protein and mRNA expressions, indicating that Dll4 is a physiological target of Tis11b
21726900 The receptors Notch2, -3, -4 and their ligands Jagged1, -2 and Delta1, -4 were detected at both the mRNA and protein level in early and late placenta
21526177 Dll4 play an important role in choroidal neovascularization (CNV) angiogenesis, which appears to be regulated by HIF-1alpha and VEGF during the progression of CNV under hypoxic conditions.
21517260 Expression of DLL4, VEGF and HIF-1alpha was very strong in gliomas.
21474814 SiRNA-mediated knockdown of alpha2beta1 and alpha6beta1 integrins abolishes Dll4 induction, which discloses a selective integrin signaling acting upstream of Notch pathway
21372153 we have investigated their influence on early human hematopoiesis and show that Jagged2 affects hematopoietic lineage decisions very similarly as Delta-like-1 and -4, but very different from Jagged1
21362320 Through activating the Dll4-Notch-Hey2 signaling pathway, HGF indirectly promotes the proliferation and migration ability of cells, so that offspring artery branches are formed.
21362319 DLL4 signaling appears to play an essential role in the biological behavior of choroid vascular endothelial cells under hypoxia.
21212269 the Ang1/Tie2 signal potentiates basal Notch signal controlling vascular quiescence by up-regulating Dll4 through AKT-mediated activation of beta-catenin.
21045140 Studies indicate that different receptors and ligands expression in breast cancer and various ways in which the pathway can be inhibited.
20959466 DLL4 could propagate its own expression and enable synchronization of NOTCH expression and signaling between ECs.
20558614 exosomes can transfer the Dll4 protein to other endothelial cells and incorporate it into their cell membrane, which results in an inhibition of Notch signaling and a loss of Notch receptor
20508179 Dll4/Notch interaction is essential for proper reparative angiogenesis. Moreover, Dll4/Notch signaling regulates sprouting angiogenesis and coordinates the interaction between inflammation and angiogenesis under ischemic conditions.
20193271 Inhibiting the Dll4/Notch signal transduction pathway stimulates the proliferation of HUVEC and facilitates angiogenesis.
20182391 Results suggests that cell-to-cell interaction via DLL4-Notch signaling pathway has been implicated in tumor angiogenesis, and control of this pathway can be a new therapeutic approach to solid tumor.
20167860 vascular notch ligand delta-like 4 is expressed with inflammatory markers in breast cancer
20167561 This review focuses on negative regulators of angiogenesis delta-like 4 and vasohibin 1 produced by endothelial cells.
20036815 Studies indicate that the imbalance of pro-angiogenic and anti-angiogenic factors VEGFA, Notch, Dll4, PDGF and angiopoietin-1 promotes tumor angiogenesis.
19816565 possible complementary role for JAG1 and DLL4 in the context of Kaposi sarcoma.
19263417 dynamic changes in neurite morphology were rapidly reversible and dependent on the activation of the Notch signaling pathway
19208840 Escape of human T-cell acute lymphoblastic leukemia cells from dormancy is associated with increased Notch3 signaling in tumor cells
18577711 retrovirus-induced over-expression of Dll4 in tumor cells activates Notch signaling in cocultured endothelial cells and limits vascular endothelial growth factor-induced endothelial cell growth
18435556 Global intrinsic (conformational) disorder, in concert with local preorganization, may play a role in Notch signaling mediated by Delta-4.
18339870 Dll4 may contribute to vascular differentiation and inhibition of the angiogenic response by regulating multiple receptor pathways.
18056450 Overexpression of Delta-like 4 Notch ligand regulates tumor angiogenesis, improves tumor vascular function, and promotes tumor growth
18055448 The effects of a soluble form of Delta4 (solD4) by exposing CD34+CD38(low) cells to S17 feeders engineered to express solD4 (solD4/S17), were assessed.
17998388 integrated role of dll4 with interleukin-12 demonstrated that, together, both of these instructive signals direct the immune response toward a more competent, less pathogenic antiviral response.
17916635 Endometrial Dll4 may enhance the development of the endometrial microvascular system and facilitate the implantation of blastocyst in a fertile cycle.
17822320 Overexpression of DLL4 is associated with breast cancer
17692341 Dll4 expression acts as a switch from the proliferative phase of angiogenesis to the maturation and stabilisation phase by blocking endothelial cell proliferation and allowing induction of a more mature, differentiated phenotype.
17664272 Notch1 ligand, Delta-like ligand-4, stimulates R-Ras-dependent alpha 5 beta 1 integrin-mediated adhesion, demonstrating the physiological relevance of this pathway.
17533181 Dll4-triggered Notch signaling may mediate inflammatory responses in macrophages and promote inflammation.
17157169 CD34+ cord blood progenitors were exposed for 4 days to either immobilized Notch ligand Delta-4. Delta-4 priming led to an acceleration of T-cell development, including a completion of the TCR rearrangement.
16914569 DLL4 expression is associated with vascular differentiation in bladder cancer.
16204037 DLL4 expression is essential for tumor angiogenesis.
15820317 DLL4 not associated with susceptibility to periodic catatonia in German patients from 15q15 linked families
14990974 upon transduction into cord blood CD34+ stem cells, DLL4 induced a 25-fold reduction in nucleated cell production by maintaining a higher proportion of cells in G0/G1 phase; specific retention of CD34+ cells throughout the culture was observed.
12684674 suppresses the self-renewal capacity and long-term growth of two myeloblastic leukemia cell lines
12482957 We show here that vascular endothelial growth factor but not basic fibroblast growth factor can induce gene expression of Notch1 and Dll4, in human arterial endothelial cells. The VEGF-induced specific signaling is mediated through VEGF receptors 1 and 2
12200365 Ectopic expression of human Delta4 in mice by retroviral gene delivery impairs hematopoietic development and leads to lymphoproliferative disease.

AA Sequence

MAAASRSASGWALLLLVALWQQRAAGSGVFQLQLQEFINERGVLASGRPCEPGCRTFFRVCLKHFQAVVS      1 - 70
PGPCTFGTVSTPVLGTNSFAVRDDSSGGGRNPLQLPFNFTWPGTFSLIIEAWHAPGDDLRPEALPPDALI     71 - 140
SKIAIQGSLAVGQNWLLDEQTSTLTRLRYSYRVICSDNYYGDNCSRLCKKRNDHFGHYVCQPDGNLSCLP    141 - 210
GWTGEYCQQPICLSGCHEQNGYCSKPAECLCRPGWQGRLCNECIPHNGCRHGTCSTPWQCTCDEGWGGLF    211 - 280
CDQDLNYCTHHSPCKNGATCSNSGQRSYTCTCRPGYTGVDCELELSECDSNPCRNGGSCKDQEDGYHCLC    281 - 350
PPGYYGLHCEHSTLSCADSPCFNGGSCRERNQGANYACECPPNFTGSNCEKKVDRCTSNPCANGGQCLNR    351 - 420
GPSRMCRCRPGFTGTYCELHVSDCARNPCAHGGTCHDLENGLMCTCPAGFSGRRCEVRTSIDACASSPCF    421 - 490
NRATCYTDLSTDTFVCNCPYGFVGSRCEFPVGLPPSFPWVAVSLGVGLAVLLVLLGMVAVAVRQLRLRRP    491 - 560
DDGSREAMNNLSDFQKDNLIPAAQLKNTNQKKELEVDCGLDKSNCGKQQNHTLDYNLAPGPLGRGTMPGK    561 - 630
FPHSDKSLGEKAPLRLHSEKPECRISAICSPRDSMYQSVCLISEERNECVIATEV                   631 - 685
//

Text Mined References (102)

PMID Year Title
27487663 2016 [CHANGES OF THE CONTENT OF DLL4 AND Jag-1 ANGIOGENESIS REGULATORS IN HUMAN DERMIS IN ONTOGENESIS].
26870802 2015 Cyclic AMP Response Element Binding Protein Mediates Pathological Retinal Neovascularization via Modulating DLL4-NOTCH1 Signaling.
26808710 2016 Arterialization and anomalous vein wall remodeling in varicose veins is associated with upregulated FoxC2-Dll4 pathway.
26739060 2016 MMGZ01, an anti-DLL4 monoclonal antibody, promotes nonfunctional vessels and inhibits breast tumor growth.
26712946 2016 The Notch Ligand DLL4 Defines a Capability of Human Dendritic Cells in Regulating Th1 and Th17 Differentiation.
26546995 2016 The Vascular Notch Ligands Delta-Like Ligand 4 (DLL4) and Jagged1 (JAG1) Have Opposing Correlations with Microvascularization but a Uniform Prognostic Effect in Primary Glioblastoma: A Preliminary Study.
26471266 2015 DLL4/Notch1 and BMP9 Interdependent Signaling Induces Human Endothelial Cell Quiescence via P27KIP1 and Thrombospondin-1.
26404485 2015 Macrophage Notch Ligand Delta-Like 4 Promotes Vein Graft Lesion Development: Implications for the Treatment of Vein Graft Failure.
26299364 2015 Heterozygous Loss-of-Function Mutations in DLL4 Cause Adams-Oliver Syndrome.
26241546 2015 Prognostic significance of DLL4 expression in papillary thyroid cancer.
26212082 2015 The role of Delta-like 4 ligand/Notch-ephrin-B2 cascade in the pathogenesis of preeclampsia by regulating functions of endothelial progenitor cell.
26111775 2015 Expression of delta-like 4 (Drosophila) and vascular endothelial growth factor A in colon cancer and association with tumour angiogenesis.
26070613 2015 Expression levels of Notch1 and Delta-like 4 in peripheral lymphocytes and their relationship with T helper 17 (Th17) cells in renal transplant recipients.
26062426 2015 [IL-23 promotes invasion of esophageal squamous cell carcinoma cells by activating DLL4/Notch1 signaling pathway].
25986715 2015 Overexpressions of DLL4 and CD105 are Associated with Poor Prognosis of Patients with Pancreatic Ductal Adenocarcinoma.
25833803 2015 Endothelial cells-targeted soluble human Delta-like 4 suppresses both physiological and pathological ocular angiogenesis.
25355291 2015 DLL4 regulates NOTCH signaling and growth of T acute lymphoblastic leukemia cells in NOD/SCID mice.
25348865 2014 Maturation-associated Dbf4 expression is essential for mouse zygotic DNA replication.
25260720 2014 Aberrant expression of ?-like ligand 4 contributes significantly to axillary lymph node metastasis and predicts postoperative outcome in breast cancer.
25139440 2014 Novel paracrine modulation of Notch-DLL4 signaling by fibulin-3 promotes angiogenesis in high-grade gliomas.
25130545 2014 The disintegrin and metalloproteinase ADAM10 mediates a canonical Notch-dependent regulation of IL-6 through Dll4 in human endothelial cells.
25041739 2015 Dengue virus up-regulates expression of notch ligands Dll1 and Dll4 through interferon-? signalling pathway.
24966922 2014 Delta-like ligand 4 (Dll4) predicts the prognosis of clear cell renal cell carcinoma, and anti-Dll4 suppresses tumor growth in vivo.
24949865 2014 The expression of VEGF and Dll4/Notch pathway molecules in ovarian cancer.
24931473 2014 Endothelial Delta-like 4 (DLL4) promotes renal cell carcinoma hematogenous metastasis.
24696220 2014 Delta-like ligand 4 (DLL4) in the plasma and neoplastic tissues from breast cancer patients: correlation with metastasis.
24615277 2014 IFN?-responsiveness of endothelial cells leads to efficient angiostasis in tumours involving down-regulation of Dll4.
24504253 2014 Dll4-containing exosomes induce capillary sprout retraction in a 3D microenvironment.
24394305 2014 Expression of Notch signaling components in cutaneous foreign body and sarcoidal granulomas and fusing macrophages.
24025447 2013 Synaptojanin-2 binding protein stabilizes the Notch ligands DLL1 and DLL4 and inhibits sprouting angiogenesis.
24025398 2013 Expanding role of delta-like 4 mediated notch signaling in cardiovascular and metabolic diseases.
23950980 2013 Association of Dll4/notch and HIF-1a -VEGF signaling in the angiogenesis of missed abortion.
23901223 2013 Influence of up-regulation of Notch ligand DLL4 on biological behaviors of human gastric cancer cells.
23898884 2013 Clinical implications of DLL4 expression in gastric cancer.
23839946 2013 Intrinsic selectivity of Notch 1 for Delta-like 4 over Delta-like 1.
23817492 2013 miR-30a regulates endothelial tip cell formation and arteriolar branching.
23787764 2013 Implications of Dll4-Notch signaling activation in primary glioblastoma multiforme.
23388056 2013 Loss of CCM3 impairs DLL4-Notch signalling: implication in endothelial angiogenesis and in inherited cerebral cavernous malformations.
23300864 2012 No evidence for a functional role of bi-directional Notch signaling during angiogenesis.
23275120 2013 Elevated DLL4 expression is correlated with VEGF and predicts poor prognosis of nasopharyngeal carcinoma.
23239744 2013 Cross-talk between leukemic and endothelial cells promotes angiogenesis by VEGF activation of the Notch/Dll4 pathway.
23207622 2012 Delta-like ligand 4 correlates with endothelial proliferation and vessel maturation in human malignant glioma.
23108591 2013 High DLL4 expression in tumour-associated vessels predicts for favorable radiotherapy outcome in locally advanced squamous cell head-neck cancer (HNSCC).
23086751 2012 The microRNA-30 family targets DLL4 to modulate endothelial cell behavior during angiogenesis.
22699504 2012 Notch ligand delta-like 4 blockade attenuates atherosclerosis and metabolic disorders.
22589738 2012 Genome-wide association for abdominal subcutaneous and visceral adipose reveals a novel locus for visceral fat in women.
22296176 2012 Expression of vascular Notch ligands Delta-like 4 and Jagged-1 in glioblastoma.
22066479 2011 Delta-like 4/Notch pathway is differentially regulated in benign and malignant thyroid tissues.
22020917 2012 Combination DLL4 with Jagged1-siRNA can enhance inhibition of the proliferation and invasiveness activity of human gastric carcinoma by Notch1/VEGF pathway.
22010178 2011 Delta-like ligand 4-notch blockade and tumor radiation response.
21832157 2011 A novel function of Tis11b/BRF1 as a regulator of Dll4 mRNA 3'-end processing.
21726900 2011 Expression patterns of Notch receptors and their ligands Jagged and Delta in human placenta.
21526177 2011 Influence of Dll4 via HIF-1?-VEGF signaling on the angiogenesis of choroidal neovascularization under hypoxic conditions.
21517260 2011 Correlation of Delta-like ligand 4 (DLL4) with VEGF and HIF-1? expression in human glioma.
21474814 2011 Laminin-binding integrins induce Dll4 expression and Notch signaling in endothelial cells.
21372153 2011 Jagged2 acts as a Delta-like Notch ligand during early hematopoietic cell fate decisions.
21362320 2011 Effects of hepatocyte growth factor-mediated activation of Dll4-Notch-Hey2 signaling pathway.
21362319 2011 Effect of DLL4 siRNA on proliferation, migration and tube formation of choroid-retinal endothelial cells under hypoxic conditions.
21212269 2011 Angiopoietin-1/Tie2 signal augments basal Notch signal controlling vascular quiescence by inducing delta-like 4 expression through AKT-mediated activation of beta-catenin.
21045140 2010 Breast cancer stem cells: something out of notching?
20959466 2010 Feed-forward signaling by membrane-bound ligand receptor circuit: the case of NOTCH DELTA-like 4 ligand in endothelial cells.
20616313 2010 Integrin cytoplasmic domain-associated protein-1 attenuates sprouting angiogenesis.
20558614 2010 New mechanism for Notch signaling to endothelium at a distance by Delta-like 4 incorporation into exosomes.
20508179 2010 Inhibition of delta-like-4-mediated signaling impairs reparative angiogenesis after ischemia.
20193271 2009 [Influence of Delta-like ligand 4/Notch signal transduction pathway upon the biological behavior of human umbilical vein endothelial cells].
20182391 2010 Blockade of delta-like ligand 4 signaling inhibits both growth and angiogenesis of pancreatic cancer.
20167860 2010 Expression of vascular notch ligand delta-like 4 and inflammatory markers in breast cancer.
20167561 2009 Delta-like 4 and vasohibin 1: two endothelium-produced negative regulators of angiogenesis with distinctive roles.
20036815 2010 Regulation of tumor angiogenesis by the local environment.
19816565 2009 KSHV manipulates Notch signaling by DLL4 and JAG1 to alter cell cycle genes in lymphatic endothelia.
19263417 2009 Notch activation induces neurite remodeling and functional modifications in SH-SY5Y neuronal cells.
19208840 2009 Cross-talk between tumor and endothelial cells involving the Notch3-Dll4 interaction marks escape from tumor dormancy.
18577711 2008 Dll4 activation of Notch signaling reduces tumor vascularity and inhibits tumor growth.
18435556 2008 Prevalence of intrinsic disorder in the intracellular region of human single-pass type I proteins: the case of the notch ligand Delta-4.
18339870 2008 Regulation of CXCR4 by the Notch ligand delta-like 4 in endothelial cells.
18056450 2007 Delta-like 4 Notch ligand regulates tumor angiogenesis, improves tumor vascular function, and promotes tumor growth in vivo.
18055448 2008 Distinct effects of the soluble versus membrane-bound forms of the notch ligand delta-4 on human CD34+CD38low cell expansion and differentiation.
17998388 2007 Notch ligand Delta-like 4 regulates disease pathogenesis during respiratory viral infections by modulating Th2 cytokines.
17916635 2008 Expression of Delta-like protein 4 in the human endometrium.
17822320 2007 A study on Notch signaling in human breast cancer.
17728344 2007 A regulatory network involving Foxn4, Mash1 and delta-like 4/Notch1 generates V2a and V2b spinal interneurons from a common progenitor pool.
17692341 2008 Regulation of multiple angiogenic pathways by Dll4 and Notch in human umbilical vein endothelial cells.
17664272 2007 Mammalian NOTCH-1 activates beta1 integrins via the small GTPase R-Ras.
17533181 2007 Delta-like 4 induces notch signaling in macrophages: implications for inflammation.
17157169 2006 Short exposure to Notch ligand Delta-4 is sufficient to induce T-cell differentiation program and to increase the T cell potential of primary human CD34+ cells.
16914569 2006 Up-regulation of endothelial delta-like 4 expression correlates with vessel maturation in bladder cancer.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16204037 2005 Up-regulation of delta-like 4 ligand in human tumor vasculature and the role of basal expression in endothelial cell function.
15820317 2005 No causative DLL4 mutations in periodic catatonia patients from 15q15 linked families.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15340161 2004 Signal peptide prediction based on analysis of experimentally verified cleavage sites.
14990974 2004 Membrane-bound delta-4 notch ligand reduces the proliferative activity of primitive human hematopoietic CD34+CD38low cells while maintaining their LTC-IC potential.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12814948 2003 Notch signaling in primary endothelial cells.
12684674 2003 Notch ligands, Delta-1 and Delta-4 suppress the self-renewal capacity and long-term growth of two myeloblastic leukemia cell lines.
12482957 2003 Regulation of Notch1 and Dll4 by vascular endothelial growth factor in arterial endothelial cells: implications for modulating arteriogenesis and angiogenesis.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12200365 2002 Ectopic expression of Delta4 impairs hematopoietic development and leads to lymphoproliferative disease.
11798067 2001 Delta4, an endothelial specific notch ligand expressed at sites of physiological and tumor angiogenesis.
11739188 2001 A novel Notch ligand, Dll4, induces T-cell leukemia/lymphoma when overexpressed in mice by retroviral-mediated gene transfer.
11134954 2001 Molecular cloning of delta-4, a new mouse and human Notch ligand.
10837024 2000 Dll4, a novel Notch ligand expressed in arterial endothelium.