Property Summary

NCBI Gene PubMed Count 80
PubMed Score 1168.85
PubTator Score 227.09

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
astrocytic glioma 2.900 7.0e-03
ependymoma 2.900 2.0e-02
oligodendroglioma 3.100 5.7e-03
medulloblastoma, large-cell -2.000 2.2e-03
primitive neuroectodermal tumor 2.100 5.3e-03
juvenile dermatomyositis 1.214 5.0e-12
adrenocortical carcinoma -1.241 2.3e-02
group 3 medulloblastoma 1.600 1.9e-02
pilocytic astrocytoma 1.200 4.5e-03
lung adenocarcinoma -1.300 5.9e-06
psoriasis -1.400 1.6e-10
Breast cancer -1.200 2.4e-04
chronic rhinosinusitis -1.246 2.7e-02

Gene RIF (56)

PMID Text
26014475 altered Notch signaling via methylation of DLL1 is likely involved in possible disease-related mechanisms of early onset preeclampsia
25715738 determined the X-ray crystal structure of the extracellular domain of the Notch ligand delta-like ligand-1 (Dll-1)
25367118 Delta-like 1-mediated Notch signaling enhances the in vitro conversion of human memory CD4 T cells into FOXP3-expressing regulatory T cells.
25041739 Dengue virus up-regulates expression of notch ligands Dll1 and Dll4 through interferon-beta signalling pathway.
24714813 Notch ligand Dll1 may enhance the adhesion and metastasis of melanoma cells by upregulation of N-cadherin.
24243972 Although Delta1 activates signal transducer and activator of transcription 3 signaling similarly to the gp130-activating cytokine interleukin-6 (IL-6), it has opposite effects on myeloid cell production.
24025447 Synaptojanin-2 binding protein stabilizes the Notch ligands DLL1 and DLL4 and inhibits sprouting angiogenesis.
23839946 direct measurement of the binding affinity of Notch1 EGF repeats 6-15 for Dll1 and Dll4 revealed that Dll4 binds with at least an order of magnitude higher affinity than Dll1
23769341 Data suggest that overexpression of Delta-Like1 (DLL1) in small cell lung cancer may increase the sensitivity of cells to chemotherapeutic agents.
23327670 MiR-34a reduced cell proliferation and invasiveness, at least, partially through its inhibitory effect on DLL1 in choriocarcinoma.
23300864 Overexpresion of DLL1 in endothelial cells inhibited cell proliferation, but did not affect cell migration, sprouting angiogenesis or cell adhesion.
22561395 Twenty-one SNPs were genotyped in 941 visceral leishmaniasis cases and 992 controls. Gene expression profiling was done and DLL1 was the only gene to show differential expression that was higher (P<0.0001) in pre- compared to post-treatment samples.
22094583 Dll1 and Notch interaction accelerates multiple myeloma disease development by promoting CD138+ MM-cell proliferation.
22080880 Notch1, Jagged1, and Delta1 expressions might be useful markers for clinical prognosis of ovarian carcinomas.
21949024 An anti-delta1 Notch protein-blocking monoclonal antibody is able to prolong allograft survival in a fully histocompatibility-mismatched model of cardiac transplantation.
21931765 MiR-34a targeting of Notch ligand delta-like 1 impairs CD15+/CD133+ tumor-propagating cells and supports neural differentiation in medulloblastoma
21911304 as compared to MSC, OP9 cells were more efficient at inducing self-renewal and/or de novo generation of primitive (CD34(+) CD38(-) Lin(-)) cells, and suggest that such effects were due, at least in part, to the presence of Jagged-1 and DL1.
21742847 DLL1, which encodes Delta-like 1, the ligand for Notch3, is strongly implicated as the chromosome 6q27 Visceral leishmaniasis susceptibility gene.
21726900 The receptors Notch2, -3, -4 and their ligands Jagged1, -2 and Delta1, -4 were detected at both the mRNA and protein level in early and late placenta
21643850 regulates Notch1 signaling through disruption of the Notch1-IC-RBP-Jk transcription activator complex
21602795 Notch1 and its ligand Delta-like 1(DLL1) are miR-449 bona fide targets
21602525 The stromal cell-mediated antiapoptotic effect on B- ALL cells is mediated by Notch-3 and -4 or Jagged-1/-2 and DLL-1 in a synergistic manner.
21392732 growth rate of Delta1-deficient dental pulp stem cells was significantly suppressed as compared with wild type cells
21372153 we have investigated their influence on early human hematopoiesis and show that Jagged2 affects hematopoietic lineage decisions very similarly as Delta-like-1 and -4, but very different from Jagged1
21238798 In this study, Delta 1 ligand was detected in the lining epithelium of human periapical cysts with limited inflammation, showing Notch pathway activation in those cells.
21196490 findings implicate DLL1 in early patterning of the forebrain and identify NOTCH as a new signaling pathway involved in Holoprosencephaly.
20812035 Relapse-free survival and overall survival showed a significantly shorter survival in acute myeloid leukemia patients with higher Notch1 expression, higher Jagged1 expression, or higher Delta1 expression.
20554499 Delta1 protein is involved in the cytodifferentiation of squamous odontogenic tumors of the mandible.
20418862 revealed a striking difference between the responses of Notch to trans- and cis-Delta: whereas the response to trans-Delta is graded, the response to cis-Delta is sharp and occurs at a fixed threshold, independent of trans-Delta
20170633 these results suggest a link between Dll1 expression and human goblet cell differentiation that might be mediated by a function that is distinct from its role as a Notch receptor ligand.
19724883 Findings suggest a positive feedback loop between Notch1 and DLL1 in the U251MG glioma cell line.
19680556 Observational study of gene-disease association. (HuGE Navigator)
19603167 DLL1 was found downregulated in immune thrombocytopenic purpura.
19590514 Observational study of gene-disease association. (HuGE Navigator)
19150223 Delta1 and Jagged1 are expressed in human umbilical cord epithelial cells at the mRNA and protein level.
18676613 The intracellular region of Notch ligands Dll1 and Dll3 regulates their trafficking and signaling activity
18320325 Report the antitumor effects of COX2 inhibitors may be associated with effects on the Delta1/Notch1 pathway in colon tumor cells.
17939407 Notch ligand Delta-1 enhances the sIL-6R-mediated effects of IL-6 on the generation of erythroid cells.
17584735 Tbx18 interacts with Gata4 and Nkx2-5 and competes Tbx5-mediated activation of the cardiac Natriuretic peptide precursor type a-promoter. Tbx18 down-regulates Tbx6-activated Delta-like 1 expression in the somitic mesoderm in vivo
17301032 with supervised resistance exercise training, expression of Notch1 and Hes6 genes were increased and Delta-like 1 and Numb expression were decreased.
17234965 Dll1 was expressed in arterial endothelial cells, not venous Ecs or capillaries. Notch signaling by induction of Dll1 is necessary & sufficient to regulate ephrin-B2 expression & EphB2- & EphB4-dependent branching morphogenesis in arterial EC.
16317090 DL1-induced activation of the Notch1 pathway controls the lineage commitment of early thymic precursors by altering the levels between Spi-B and GATA-3.
16307184 Data describe the immunohistochemical staining pattern of four Notch receptors (Notch1-4) and their ligands (Delta1 and Jagged1) in synovial tissues obtained from rheumatoid arthritis patients.
16225865 The expression of the intracellular domain of Delta1 results in a non-proliferating senescent-like cell phenotype which is dependent on the expression of the cell cycle inhibitor, p21.
15976178 culture with increased amounts of Delta1(ext-IgG) induced apoptosis of CD34+ precursors resulting in decreased cell numbers, without affecting generation of CD7+ cells
15908431 Dll1 is presented on the surface of AJs formed at the apical termini of processes through interaction with MAGI1 to activate Notch on neighboring cells in the developing central nervous system
15905513 When a dominant-negative form of kuzmanian in transgenic mice impairs Notch signaling in receiving T-cells, increasing Delta-1 on sending cells overcomes this defect.
15851488 Density of the Notch ligand Delta1 determines generation of B and T cell precursors from hematopoietic stem cells.
15781650 Down-regulation of Notch-1, Delta-like-1, or Jagged-1 by RNA interference induces apoptosis and inhibits proliferation in multiple glioma cell lines.
15492857 Notch ligand, Delta-1, reduced the TNF-alpha-induced growth suppression and apoptosis in U937 cells.
15254769 Delta-1 and Jagged-1 have roles in growth suppression in two myeloid leukemia cell lines
14769803 induces a NIH 3T3 cell tranformed phenotype mediated by FGF signaling.
12826675 Delta and Jagged undergo ADAM-mediated ectodomain processing followed by PS-mediated intramembrane proteolysis to release signaling fragments
12794186 Dll1 is a substrate for regulated intramembrane proteolysis, and its intracellular region possibly fulfills a specific function in the nucleus
12684674 suppresses the self-renewal capacity and long-term growth of two myeloblastic leukemia cell lines
12393852 Delta-1 can enhance myeloid and lymphoid marrow-repopulating ability and promote the generation of thymus-repopulating T cell precursors.

AA Sequence

MGSRCALALAVLSALLCQVWSSGVFELKLQEFVNKKGLLGNRNCCRGGAGPPPCACRTFFRVCLKHYQAS      1 - 70
VSPEPPCTYGSAVTPVLGVDSFSLPDGGGADSAFSNPIRFPFGFTWPGTFSLIIEALHTDSPDDLATENP     71 - 140
ERLISRLATQRHLTVGEEWSQDLHSSGRTDLKYSYRFVCDEHYYGEGCSVFCRPRDDAFGHFTCGERGEK    141 - 210
VCNPGWKGPYCTEPICLPGCDEQHGFCDKPGECKCRVGWQGRYCDECIRYPGCLHGTCQQPWQCNCQEGW    211 - 280
GGLFCNQDLNYCTHHKPCKNGATCTNTGQGSYTCSCRPGYTGATCELGIDECDPSPCKNGGSCTDLENSY    281 - 350
SCTCPPGFYGKICELSAMTCADGPCFNGGRCSDSPDGGYSCRCPVGYSGFNCEKKIDYCSSSPCSNGAKC    351 - 420
VDLGDAYLCRCQAGFSGRHCDDNVDDCASSPCANGGTCRDGVNDFSCTCPPGYTGRNCSAPVSRCEHAPC    421 - 490
HNGATCHERGHRYVCECARGYGGPNCQFLLPELPPGPAVVDLTEKLEGQGGPFPWVAVCAGVILVLMLLL    491 - 560
GCAAVVVCVRLRLQKHRPPADPCRGETETMNNLANCQREKDISVSIIGATQIKNTNKKADFHGDHSADKN    561 - 630
GFKARYPAVDYNLVQDLKGDDTAVRDAHSKRDTKCQPQGSSGEEKGTPTTLRGGEASERKRPDSGCSTSK    631 - 700
DTKYQSVYVISEEKDECVIATEV                                                   701 - 723
//

Text Mined References (80)

PMID Year Title
26014475 2015 Alteration of Delta-like ligand 1 and Notch 1 receptor in various placental disorders with special reference to early onset preeclampsia.
25715738 2015 Notch ligand delta-like1: X-ray crystal structure and binding affinity.
25367118 2014 Delta-like 1-mediated Notch signaling enhances the in vitro conversion of human memory CD4 T cells into FOXP3-expressing regulatory T cells.
25338677 Genetic analysis of the pathogenic molecular sub-phenotype interferon-alpha identifies multiple novel loci involved in systemic lupus erythematosus.
25041739 2015 Dengue virus up-regulates expression of notch ligands Dll1 and Dll4 through interferon-? signalling pathway.
24714813 2014 Notch ligand Delta-like 1 promotes the metastasis of melanoma by enhancing tumor adhesion.
24243972 2014 Blood stem cell fate regulation by Delta-1-mediated rewiring of IL-6 paracrine signaling.
24025447 2013 Synaptojanin-2 binding protein stabilizes the Notch ligands DLL1 and DLL4 and inhibits sprouting angiogenesis.
23839946 2013 Intrinsic selectivity of Notch 1 for Delta-like 4 over Delta-like 1.
23769341 2013 [Up-regulation of DLL1 may promote the chemotherapeutic sensitivity in small cell lung cancer].
23327670 2013 MicroRNA-34a is a tumor suppressor in choriocarcinoma via regulation of Delta-like1.
23300864 2012 No evidence for a functional role of bi-directional Notch signaling during angiogenesis.
23086448 2012 The CD46-Jagged1 interaction is critical for human TH1 immunity.
22561395 2012 Genetic and functional evaluation of the role of DLL1 in susceptibility to visceral leishmaniasis in India.
22094583 2012 Dll1/Notch activation accelerates multiple myeloma disease development by promoting CD138+ MM-cell proliferation.
22080880 2012 Cancer stem cell and embryonic development-associated molecules contribute to prognostic significance in ovarian cancer.
21980299 2011 A genome-wide meta-analysis of six type 1 diabetes cohorts identifies multiple associated loci.
21949024 2011 Blockade of Notch ligand ?1 promotes allograft survival by inhibiting alloreactive Th1 cells and cytotoxic T cell generation.
21931765 2011 MiR-34a targeting of Notch ligand delta-like 1 impairs CD15+/CD133+ tumor-propagating cells and supports neural differentiation in medulloblastoma.
21911304 2011 In vitro effects of stromal cells expressing different levels of Jagged-1 and Delta-1 on the growth of primitive and intermediate CD34(+) cell subsets from human cord blood.
21742847 2011 Genetic and functional evidence implicating DLL1 as the gene that influences susceptibility to visceral leishmaniasis at chromosome 6q27.
21726900 2011 Expression patterns of Notch receptors and their ligands Jagged and Delta in human placenta.
21643850 2011 Regulation of Notch1 signaling by Delta-like ligand 1 intracellular domain through physical interaction.
21602795 2011 Control of vertebrate multiciliogenesis by miR-449 through direct repression of the Delta/Notch pathway.
21602525 2011 Notch-3 and Notch-4 signaling rescue from apoptosis human B-ALL cells in contact with human bone marrow-derived mesenchymal stromal cells.
21392732 2011 Inhibition of Delta1 promotes differentiation of odontoblasts and inhibits proliferation of human dental pulp stem cell in vitro.
21372153 2011 Jagged2 acts as a Delta-like Notch ligand during early hematopoietic cell fate decisions.
21238798 2011 Immunohistochemical expression of Notch signaling in the lining epithelium of periapical cysts.
21196490 2011 NOTCH, a new signaling pathway implicated in holoprosencephaly.
20812035 2011 Activation of Notch signal pathway is associated with a poorer prognosis in acute myeloid leukemia.
20554499 2010 Squamous odontogenic tumor of the mandible: a case report demonstrating immunoexpression of Notch1, 3, 4, Jagged1 and Delta1.
20418862 2010 Cis-interactions between Notch and Delta generate mutually exclusive signalling states.
20170633 2010 Delta-like 1 expression promotes goblet cell differentiation in Notch-inactivated human colonic epithelial cells.
19906316 2009 Discovery of novel human transcript variants by analysis of intronic single-block EST with polyadenylation site.
19724883 2009 Notch1 induces enhanced expression of Delta-like-1 in the U251MG glioma cell line.
19682396 2009 Notch signaling is required for maintaining stem-cell features of neuroprogenitor cells derived from human embryonic stem cells.
19680556 2009 Genetic variation in healthy oldest-old.
19603167 2010 Aberrant expression of Notch signaling molecules in patients with immune thrombocytopenic purpura.
19590514 2009 FGFR2 is associated with hair thickness in Asian populations.
19150223 2009 Human umbilical cord epithelial cells express Notch ligands Delta1 and Jagged1.
18676613 2008 The intracellular region of Notch ligands Dll1 and Dll3 regulates their trafficking and signaling activity.
18320325 2008 The COX-2 selective inhibitor-independent COX-2 effect on colon carcinoma cells is associated with the Delta1/Notch1 pathway.
17939407 2007 [Effect of Notch ligand Delta-1 on the differentiation and maturation of erythroid progenitors in humans].
17584735 2007 Transcriptional repression by the T-box proteins Tbx18 and Tbx15 depends on Groucho corepressors.
17301032 2007 Impaired expression of Notch signaling genes in aged human skeletal muscle.
17234965 2007 Notch ligand Delta-like 1 is essential for postnatal arteriogenesis.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16317090 2006 Delta-like1-induced Notch1 signaling regulates the human plasmacytoid dendritic cell versus T-cell lineage decision through control of GATA-3 and Spi-B.
16307184 2005 Immunohistological localization of Notch receptors and their ligands Delta and Jagged in synovial tissues of rheumatoid arthritis.
16225865 2005 The intracellular domain of Notch ligand Delta1 induces cell growth arrest.
15976178 2005 Dose-dependent effects of the Notch ligand Delta1 on ex vivo differentiation and in vivo marrow repopulating ability of cord blood cells.
15908431 2005 MAGI1 recruits Dll1 to cadherin-based adherens junctions and stabilizes it on the cell surface.
15905513 2005 Impairment of thymocyte development by dominant-negative Kuzbanian (ADAM-10) is rescued by the Notch ligand, delta-1.
15851488 2005 Density of the Notch ligand Delta1 determines generation of B and T cell precursors from hematopoietic stem cells.
15781650 2005 Expression of Notch-1 and its ligands, Delta-like-1 and Jagged-1, is critical for glioma cell survival and proliferation.
15509766 2004 Delta proteins and MAGI proteins: an interaction of Notch ligands with intracellular scaffolding molecules and its significance for zebrafish development.
15492857 2004 The Notch ligand, Delta-1, reduces TNF-alpha-induced growth suppression and apoptosis by decreasing activation of caspases in U937 cells.
15254769 2004 Cellular analysis of growth suppression induced by the Notch ligands, Delta-1 and Jagged-1 in two myeloid leukemia cell lines.
14769803 2004 The non-transmembrane form of Delta1, but not of Jagged1, induces normal migratory behavior accompanied by fibroblast growth factor receptor 1-dependent transformation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12826675 2003 The Notch ligands, Jagged and Delta, are sequentially processed by alpha-secretase and presenilin/gamma-secretase and release signaling fragments.
12794186 2003 The Notch ligand Delta1 is sequentially cleaved by an ADAM protease and gamma-secretase.
12684674 2003 Notch ligands, Delta-1 and Delta-4 suppress the self-renewal capacity and long-term growth of two myeloblastic leukemia cell lines.
12482954 2002 A CADASIL-mutated Notch 3 receptor exhibits impaired intracellular trafficking and maturation but normal ligand-induced signaling.
12393852 2002 Delta-1 enhances marrow and thymus repopulating ability of human CD34(+)CD38(-) cord blood cells.
12050162 2002 The nephroblastoma overexpressed gene (NOV/ccn3) protein associates with Notch1 extracellular domain and inhibits myoblast differentiation via Notch signaling pathway.
12036964 2002 Notch ligands are substrates for protein O-fucosyltransferase-1 and Fringe.
11912004 2002 The stem cell compartment in human interfollicular epidermis.
11823422 2002 Integrity of intracellular domain of Notch ligand is indispensable for cleavage required for release of the Notch2 intracellular domain.
11581320 2001 Differential effects of Notch ligands Delta-1 and Jagged-1 in human lymphoid differentiation.
11006133 2000 Physical interaction of Delta1, Jagged1, and Jagged2 with Notch1 and Notch3 receptors.
10958687 2000 Binding of Delta1, Jagged1, and Jagged2 to Notch2 rapidly induces cleavage, nuclear translocation, and hyperphosphorylation of Notch2.
10688816 2000 A soluble form of human Delta-like-1 inhibits differentiation of hematopoietic progenitor cells.
10473135 1999 Expression of Delta1 and Serrate1 (Jagged1) in the mouse inner ear.
10473134 1999 Expression of the mouse Delta1 gene during organogenesis and fetal development.
10079256 1999 Human ligands of the Notch receptor.
9882480 1998 Delta-notch signaling in odontogenesis: correlation with cytodifferentiation and evidence for feedback regulation.
9858718 1998 Distinct expression patterns of notch family receptors and ligands during development of the mammalian inner ear.