Property Summary

NCBI Gene PubMed Count 10
PubMed Score 3.82
PubTator Score 1.08

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7933 4.2e-08
malignant mesothelioma 3163 1.0e-05
diabetes mellitus 1663 1.3e-03

Expression

  Differential Expression (3)

Disease log2 FC p
malignant mesothelioma 1.200 1.0e-05
osteosarcoma 1.582 4.2e-08
diabetes mellitus 1.100 1.3e-03

Gene RIF (1)

PMID Text
17320102 Studies in mouse showed that dlk2, highly homologous to dlk1 (also known as pref-1, and FA-1) appears to modulate adipogenesis in vitro in an opposite way to that of dlk1.

AA Sequence

MPSGCRCLHLVCLLCILGAPGQPVRADDCSSHCDLAHGCCAPDGSCRCDPGWEGLHCERCVRMPGCQHGT      1 - 70
CHQPWQCICHSGWAGKFCDKDEHICTTQSPCQNGGQCMYDGGGEYHCVCLPGFHGRDCERKAGPCEQAGS     71 - 140
PCRNGGQCQDDQGFALNFTCRCLVGFVGARCEVNVDDCLMRPCANGATCLDGINRFSCLCPEGFAGRFCT    141 - 210
INLDDCASRPCQRGARCRDRVHDFDCLCPSGYGGKTCELVLPVPDPPTTVDTPLGPTSAVVVPATGPAPH    211 - 280
SAGAGLLRISVKEVVRRQEAGLGEPSLVALVVFGALTAALVLATVLLTLRAWRRGVCPPGPCCYPAPHYA    281 - 350
PACQDQECQVSMLPAGLPLPRDLPPEPGKTTAL                                         351 - 383
//

Text Mined References (10)

PMID Year Title
25093684 2014 The proteins DLK1 and DLK2 modulate NOTCH1-dependent proliferation and oncogenic potential of human SK-MEL-2 melanoma cells.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
17320102 2007 The novel gene EGFL9/Dlk2, highly homologous to Dlk1, functions as a modulator of adipogenesis.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.